KEGG   Austrofundulus limnaeus (annual killifish): 106520555
Entry
106520555         CDS       T06063                                 
Symbol
mrap
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
alim  Austrofundulus limnaeus (annual killifish)
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 106520555
NCBI-ProteinID: XP_013868183
UniProt: A0A2I4BKD3
LinkDB
Position
Unknown
AA seq 99 aa
MSISSHLGNATAVSKNDTSVTGNSSSAISYEWEYYYDYLDPVIVDESKLTYNKYSIVIIL
WISLAAFVGFLFLSLNLMSLSGKWPKIHKLRGHHRGSNA
NT seq 300 nt   +upstreamnt  +downstreamnt
atgagtatttcttcccatcttgggaacgcaacagctgtgtccaagaatgacacgtctgtg
actggaaattccagcagcgctatttcttatgaatgggagtactactatgattatcttgat
cctgtgattgtggacgagagtaagctgacatacaataaatattcgattgtcataatattg
tggataagtctggctgcatttgtgggatttctctttctcagcttgaatcttatgtctctg
agtggaaaatggccaaagatacacaaactcagaggacaccacagaggatcaaatgcttga

DBGET integrated database retrieval system