KEGG   Allobranchiibius sp. GilTou73: LVQ62_09915
Entry
LVQ62_09915       CDS       T07800                                 
Name
(GenBank) acylneuraminate cytidylyltransferase family protein
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
alx  Allobranchiibius sp. GilTou73
Pathway
alx00541  O-Antigen nucleotide sugar biosynthesis
alx01100  Metabolic pathways
alx01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:alx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    LVQ62_09915
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3
Other DBs
NCBI-ProteinID: UIJ33493
LinkDB
Position
complement(1987284..1988000)
AA seq 238 aa
MNTLCVIPVRGGSKGVPGKNLRQIEGRPLVVWTIEQALNTPGLDVLVSTDDERIAEVARS
AGADVPFLRPPELARDDTPTEPVVRHAIAHRVGEGRSPDAVMLLQATSPLRLPGTLERAM
SQFDSSGADSLVGVVPFAPFFWWQARHGQPPRADYDVTARPRRQDLTSGQLRYRETGSLY
LTRPWVYEQCDNRLGGRIELFVMDEVEGIDIDTEHDLRLAAHEMRRLAEIRSTPGGSA
NT seq 717 nt   +upstreamnt  +downstreamnt
gtgaacaccctctgtgtgatccccgtgcgcggcggctccaagggcgtgcccggcaagaat
ctgcggcagatcgagggccgtcccctcgtcgtgtggaccatcgaacaggcgctgaacaca
ccgggcctggacgtcctcgtctccaccgacgacgaacgcatcgccgaggtcgcgcgctcg
gcgggcgccgacgtgcccttcctgcggccgcccgagctggcccgggacgacacccccacc
gagccggtggtgcggcacgcgatcgcgcatcgggtgggtgagggacgatcgccggacgcc
gtgatgctgctgcaggcgacctcgccactccggctgcccggcacgctcgagcgggcgatg
agccagttcgactcctcgggagcggactcgctggtcggagtcgtgccgttcgcgccgttc
ttctggtggcaggcacgccacgggcagccgccgcgggcggactacgacgtcaccgcgcgg
ccccgccggcaggacctcacctcggggcaactgcgctaccgcgagacgggctcgctctac
ctcacccgaccatgggtctatgagcagtgcgacaaccgtctcggcggccgcatcgagctc
ttcgtgatggacgaggtggagggcatcgacatcgacaccgagcacgacctgcgcctggca
gcgcacgagatgcgtcgcctcgccgagatccgttcgacaccaggtggttccgcatga

DBGET integrated database retrieval system