KEGG   Apis mellifera (honey bee): 408398
Entry
408398            CDS       T01057                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    408398
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ame00199]
    408398
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     408398
Cytochrome P450 [BR:ame00199]
 Cytochrome P450, animal type
  CYP306 family
   408398
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 408398
NCBI-ProteinID: XP_006557887
BEEBASE: GB54743
UniProt: A0A8B6YUF1 A0A7M7GP17
LinkDB
Position
LG13:complement(2524150..2539984)
AA seq 499 aa
MILDHYIAIFVLPFLLLLYVVRKNRKARRLPPGPWQLPLLGYLPWIDAEKPHETLTRLSR
VYGPVCGFRMGSVYTVLLSDPQLIRQSFAKDSITNRAPLYLTHGIMKGYGIICAEGEQWK
DQRKFISNCLRNFGMVKHEGAKRDKMEERISDAVNECVSVLRDRGANGPIDPLDTLHHCL
GNLVNSIVFGKTYEEEDRIWKWLRHLQEEGVKQIGVAGPLNFLPFLRFLPQYGRVIRSIV
DGKDKTHEIYRQILDEHRARVDSGNGCKIDSFLAAFDEQMRKKDGAESGYFTEPQLYHLL
ADLFGAGTDTTLTTLRWFLLFMAAHPMEQEKIQSEMDLCLREGEQPTLNDRIVMPRLEAA
IAEVQRIRSVTPLGIPHGTSEDVEIGGYDIPCGAMIVPMQWAIHTDPAYWRDPLEFRPDR
FLSEDGTFFKPESFLPFQNGKRVCVGEELARMILFLFAGRILRAFSVRVPAGEIADLEGE
CGITLVPKPHRLAFVGRDR
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgattctcgaccattacatcgcgatattcgttttacccttcctccttcttctatacgtt
gttcgcaaaaatcggaaagcccgtcgtctgccgcccggtccttggcaacttccgctcctt
ggctaccttccatggatcgacgcggagaaacctcacgaaactctgacgagattgtcgcga
gtttacggccccgtgtgcggtttccgtatgggctccgtgtacaccgttttgctgtcggat
ccgcaactgatacgccaatcgttcgcaaaagactccatcacgaaccgagcgcctttgtac
cttacccacggaattatgaaaggttacggtataatttgcgcggagggggaacagtggaag
gatcagaggaaatttatcagcaactgtctgcgaaatttcggcatggtgaagcacgaagga
gcgaagcgtgacaagatggaggaacgaatatcggatgcggtgaacgaatgcgtatcagta
ttgagagatcgcggtgcgaacgggccgatcgacccgttggacaccctccaccactgcttg
ggcaatctcgtgaacagcatcgtgttcgggaaaacgtacgaggaggaagatcggatttgg
aaatggctgaggcatctgcaggaagagggcgtgaagcaaattggcgtcgctggacctctc
aactttctaccctttctcagatttctgccgcaatacggccgagtgatacggtcgatcgtc
gatgggaaggataaaacgcacgagatatatcggcaaatactggacgagcaccgggcgcga
gtcgactcggggaatggatgtaagatcgacagctttttagcggcattcgacgagcaaatg
aggaagaaagacggcgcggaatcgggatatttcaccgagccccagctctatcatttgctc
gccgatctgttcggtgctggaaccgacaccacgttgaccacccttcgttggtttctctta
ttcatggccgcccatcccatggaacaggaaaagatacagtcggaaatggatctgtgcttg
agggaaggagagcagcctactttgaacgacagaatcgtcatgccccgtctcgaggcagcc
atagccgaggtgcagaggattagaagcgttacccccctcggtatccctcacggaacatca
gaggatgtggaaataggtggttacgatataccgtgcggcgccatgatcgtgcccatgcaa
tgggctatccacacggatcccgcttactggcgcgaccccctcgaatttcgacccgacaga
ttcctgtccgaggatggaacgttcttcaagcctgagtcgtttcttccgttccaaaatggg
aaacgcgtctgcgttggagaagaattggcgagaatgatactgttcctgttcgccgggcga
attctacgcgcgttctctgtgcgtgtaccagcgggcgagatcgccgatctcgaaggcgag
tgcggtatcacgctcgtcccgaagccccatcggttggcgttcgtcgggcgggatcgatga

DBGET integrated database retrieval system