Apis mellifera (honey bee): 410610 Help Entry 410610            CDS       T01057                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism ame  Apis mellifera (honey bee) Pathway ame04070   Phosphatidylinositol signaling system ame04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:ame00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     410610  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     410610  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ame01009]     410610   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ame04131]     410610    03036 Chromosome and associated proteins [BR:ame03036]     410610   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ame04147]     410610 Protein phosphatases and associated proteins [BR:ame01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      410610 Membrane trafficking [BR:ame04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     410610 Chromosome and associated proteins [BR:ame03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      410610 Exosome [BR:ame04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    410610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 AIF-1 MTIP_N EF-hand_9 EF-hand_8 DUF5580_M Motif Other DBs NCBI-GeneID:  410610 NCBI-ProteinID:  XP_394088 BEEBASE:  GB50080 UniProt:  A0A088AF37 LinkDB All DBs Position LG15:complement(6484938..6485866) Genome browser AA seq 149 aa AA seqDB search MARYFREEDIDEFRECFYLFARNGQIRTLDELTIIMRSLGLSPTIAELNKYLKDKGGKMS FADFLEVMHLQTRAEDLPKEVIDAFQAADKFRTGTIPARQLAHMLLHWGEQLSNKEVEQI FREANVSPNGQVKYEDFVKIACAPVPDYY NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctcgttattttcgagaggaagatatagatgaattcagggaatgtttttatctattt gcaaggaatggtcaaatacgtactttggatgagcttacaatcattatgagatcattagga ttaagtccaactattgcagaattaaataaatatttgaaagataaaggtggaaaaatgtct ttcgccgatttcttggaagttatgcatctacaaactagagctgaagatttaccaaaagaa gtgatagatgcttttcaagctgcagataaatttaggactggcactataccagctagacag ttagcgcatatgttactccactggggtgaacaattgagtaacaaagaagtggagcaaatt ttcagagaggcaaatgtatctccaaatggacaagtaaagtacgaagattttgttaaaata gcttgtgcacctgtacctgattactattaa

DBGET integrated database retrieval system