KEGG   Alligator mississippiensis (American alligator): 102576047
Entry
102576047         CDS       T03087                                 
Symbol
TNFRSF8
Name
(RefSeq) TNF receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:amj00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102576047 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:amj04050]
    102576047 (TNFRSF8)
   04090 CD molecules [BR:amj04090]
    102576047 (TNFRSF8)
Cytokine receptors [BR:amj04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102576047 (TNFRSF8)
CD molecules [BR:amj04090]
 Proteins
  102576047 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 Epiglycanin_C
Other DBs
NCBI-GeneID: 102576047
NCBI-ProteinID: XP_019349366
LinkDB
Position
Un
AA seq 554 aa
MRKGTIQGLERQLSSHEESQEKLHMMETKLLGKLGETTQLTKGLTSRESLLEAGKASGLL
AKSCDKLNNQFYDEASKKCCYHCPTGSIKQTPCPTNLDKDCRWCEPEQYLKEAHPKPRCE
ACVSCMTEQDLVEKAPCTFNSSRVCECRAGFFCKMSVLNTCARCDRHTSCSPGYGVKVRG
TSKTDVTCQVCPPGTFSDRLSSTETCRPHTDCAKLSKVVMTKGNATRDQVCKDPSPNVLS
WVPTLGTFKNSTQGTEPAGVPSQHTQPPHGKSQPSHLEHPVDSRRATHTSLLSAVTSGNV
HPTAGGTAGGTDTKPAAGTFLTSSVATRKTVKEENGSFIPWVMVVLPVTLLLGAMGVFWQ
KKFCKRRIFTLIRKTAPNVYQVPTQQPRPGSQGPDLMKTCARRISMLKAEKGPEERELIT
RSPNMETNNNSPSSTEKTHGPELSLAEVNQSSGNSLDCPVDARVRDHTNNRIEKIYIMKA
DTVIVGSISEVSGGKNCAVRGYDSDAEAQENPVETDGAMHYPEQETESFPENDVMIPVEE
EGKEFHHPTTATEK
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgcggaaagggacaatacaaggtctggagagacagttgagttcccatgaggagagtcag
gagaagctccatatgatggagacgaagctgctgggaaaactgggagagaccacacagctc
accaagggactcacgagtagggaatccctcctggaagcaggcaaggcatcagggctcttg
gccaagtcctgtgacaagcttaataaccagttctacgatgaagcttcaaaaaaatgctgc
taccactgtcccacaggctccattaaacagacaccatgccctactaacttggacaaagac
tgcaggtggtgcgagcctgagcagtacctgaaggaggcacatccaaagccacgttgtgag
gcctgcgtgtcatgcatgacagaacaagacctcgtagagaaagccccctgcaccttcaat
tccagcagggtgtgcgagtgccgggcaggattcttctgtaaaatgtcagtcctgaacact
tgtgcacgatgcgaccgtcacaccagctgctctcctgggtatggagtcaaagtcagaggc
acctccaaaacagatgtcacctgccaagtgtgtcctccaggcaccttctctgaccggctt
tccagcacagaaacctgcaggccccacacagactgtgccaagctgagcaaggtagtgatg
accaaaggaaacgccacccgcgaccaagtgtgcaaagacccatctcccaacgtcctcagt
tgggtccctacgctcggaacatttaaaaacagtacccagggcactgagccagccggggtg
ccctcccaacacacccaaccccctcatgggaaaagccagccttcccaccttgagcatcct
gttgactccagacgggcaacccataccagcctcctgagcgctgtgacctctggcaatgtc
catccaactgctggaggaaccgctggtggaacagatacaaagccagctgctggcactttc
ctgacctcaagtgtagccacaaggaagactgtgaaggaagagaatggcagcttcattccc
tgggtcatggtggtcctcccagtgacgttgttgcttggggccatgggagtgttttggcaa
aagaagttttgcaagcggcggatcttcaccctcataaggaagacagctcctaatgtgtac
caagtccctacacaacaacccaggcctggatctcaagggcccgatttgatgaagacttgt
gcaaggagaatcagtatgttgaaagctgaaaaggggccagaagagagggagctaattacc
agaagccccaacatggaaaccaacaacaactcgccttccagcacagagaaaactcatggg
cctgagctgagtctggccgaggtgaaccagagcagtggaaattccctagattgcccagtc
gatgctcgtgtgagggaccacactaataaccggatcgagaaaatttatatcatgaaagca
gacacagtgattgtgggctccatctcggaagtgtccggaggcaagaactgtgccgttcga
gggtatgacagtgatgctgaggcccaagaaaacccagtggaaacggatggggcaatgcac
tatccagagcaggagacagaatcattcccagaaaacgatgtcatgattcccgtggaggag
gaagggaaagaattccatcaccccaccactgccaccgagaagtga

DBGET integrated database retrieval system