KEGG   Alligator mississippiensis (American alligator): 106739082
Entry
106739082         CDS       T03087                                 
Symbol
MRAP
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
amj  Alligator mississippiensis (American alligator)
SSDB
Motif
Pfam: MRAP EVC2_like
Other DBs
NCBI-GeneID: 106739082
NCBI-ProteinID: XP_014454516
UniProt: A0A151ME33
LinkDB
Position
Un
AA seq 88 aa
MANKTNSSEYYWSYEYYWDYFDPFPVDGRMLKVHKYSIVIAFWVGLAAFLMFLFLILLYM
SRSGSTPVKQVAINNREEENSSNGDCFT
NT seq 267 nt   +upstreamnt  +downstreamnt
atggctaacaaaacaaactcatctgagtattactggtcttatgaatattattgggactat
tttgatccatttccagtagatggaaggatgttgaaggttcataaatattcaattgtcata
gccttttgggttggacttgctgcattcttgatgtttctcttcctcattttgctctacatg
tccagatctggatccacaccagtaaaacaggtggctataaataaccgggaagaagaaaac
agctccaacggtgactgtttcacatag

DBGET integrated database retrieval system