Ailuropoda melanoleuca (giant panda): 100468151 Help Entry 100468151         CDS       T01329                                  Name (RefSeq) histone H2B type 1-A   KO K11252   histone H2B Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04613   Neutrophil extracellular trap formation aml05034   Alcoholism aml05203   Viral carcinogenesis aml05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:aml00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100468151  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100468151   09163 Immune disease    05322 Systemic lupus erythematosus     100468151   09165 Substance dependence    05034 Alcoholism     100468151  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aml03036]     100468151   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100468151 Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100468151 Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100468151 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 Motif Other DBs NCBI-GeneID:  100468151 NCBI-ProteinID:  XP_002915877 Ensembl:  ENSAMEG00000030108 UniProt:  G1MPM0 LinkDB All DBs Position 5:2492910..2493310 Genome browser AA seq 127 aa AA seqDB search MPELTSKGTTISKKGFKKAVTKTEKKEGKKRKRCRKESYSIYIYKVLKQVHPDTGISSKA MSIMNSFVSDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccggagctgacttcgaaaggcactaccatttccaagaaaggcttcaagaaagctgta accaaaactgagaagaaagaagggaaaaagcgtaagagatgccgcaaagagagctactct atttacatctacaaggtgctgaagcaggtgcaccccgacactggcatctcgtccaaggcc atgagcatcatgaattcttttgtcagtgacatcttcgagcgcatcgcaggcgaggcgtcg cgcctggcgcattacaacaagcgctcgaccatcacgtccagagagatccagacggccgtg cgcctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtc accaagtacaccagctccaagtaa

DBGET integrated database retrieval system