Ailuropoda melanoleuca (giant panda): 100468957 Help Entry 100468957         CDS       T01329                                  Symbol RAN Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml03008   Ribosome biogenesis in eukaryotes aml03013   Nucleocytoplasmic transport aml03250   Viral life cycle - HIV-1 aml05166   Human T-cell leukemia virus 1 infection Brite KEGG Orthology (KO) [BR:aml00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     100468957 (RAN)    03008 Ribosome biogenesis in eukaryotes     100468957 (RAN)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     100468957 (RAN)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100468957 (RAN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aml03019]     100468957 (RAN)    03009 Ribosome biogenesis [BR:aml03009]     100468957 (RAN)    03016 Transfer RNA biogenesis [BR:aml03016]     100468957 (RAN)    03036 Chromosome and associated proteins [BR:aml03036]     100468957 (RAN)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aml04147]     100468957 (RAN)    04031 GTP-binding proteins [BR:aml04031]     100468957 (RAN) Messenger RNA biogenesis [BR:aml03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      100468957 (RAN) Ribosome biogenesis [BR:aml03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     100468957 (RAN)   Pre-60S particles     100468957 (RAN) Transfer RNA biogenesis [BR:aml03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     100468957 (RAN) Chromosome and associated proteins [BR:aml03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      100468957 (RAN)    Spindle formation proteins     100468957 (RAN) Exosome [BR:aml04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100468957 (RAN) GTP-binding proteins [BR:aml04031]  Small (monomeric) G-proteins   Ran Family    Ran     100468957 (RAN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU G-alpha Gtr1_RagA RNA_helicase Pox_A32 ArgoMid AAA_24 AAA_7 Septin TsaE AAA_16 VapE-like_dom SRPRB AAA_33 AAA_22 Motif Other DBs NCBI-GeneID:  100468957 NCBI-ProteinID:  XP_034494467 Ensembl:  ENSAMEG00000004222 LinkDB All DBs Position 12:complement(1327166..1330628) Genome browser AA seq 237 aa AA seqDB search MWLPGRAAGPTSFSSLRSTSAMAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKY VATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYK NVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEK PFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL NT seq 714 nt NT seq  +upstreamnt  +downstreamnt atgtggctcccgggccgcgccgccggccccacgtctttctcttccctccgcagcaccagc gccatggctgcccagggagagccccaagtccagttcaaactggtgctggttggcgacggc ggcaccgggaagacaacgttcgtgaagcgtcacctgacgggtgaattcgagaagaagtat gtagccaccttgggcgtggaggtgcacccgctcgtgttccacaccaacaggggacctatc aagttcaacgtgtgggacacggccggtcaggagaaattcggcgggctgcgggacggctac tacatccaagcccagtgtgccattataatgtttgatgtcacgtcaagggttacttacaag aatgtgcctaactggcatagagatctggtacgagtgtgtgagaacatccccattgtgctg tgtggcaacaaagtggacattaaggacaggaaagttaaggcaaaatctattgtcttccac cgaaagaagaatcttcagtactatgacatttctgccaaaagtaactacaattttgaaaag cccttcctgtggcttgctagaaaactaattggagaccctaacttggagtttgtcgccatg cccgctcttgccccaccagaggttgtcatggacccagctttggcagcacagtatgagcac gatctagaggttgctcagacaactgctctcccggatgaggatgatgacctgtga

DBGET integrated database retrieval system