KEGG   Ailuropoda melanoleuca (giant panda): 100473132
Entry
100473132         CDS       T01329                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100473132 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:aml04050]
    100473132 (TNFRSF8)
   04090 CD molecules [BR:aml04090]
    100473132 (TNFRSF8)
Cytokine receptors [BR:aml04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100473132 (TNFRSF8)
CD molecules [BR:aml04090]
 Proteins
  100473132 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 100473132
NCBI-ProteinID: XP_034527282
Ensembl: ENSAMEG00000010132
LinkDB
Position
11:8851480..8916552
AA seq 608 aa
MCPLRAVLGLLLLGVLGAFPQDGVRRDTCKEGPNHSYDETAGRCCYRCPVGLTSQQPCAR
GPSDCGKQCEPDYYLDGDGRCKACVTCAGDELVEKVPCAGNASRVCECRPGMFCVTSAIN
SCARCEPHSTCAPGMVVQFRGTAERDTVCEAPSPVTSPDCSTNPEACQAPTSSTTPRAGP
LGSSSASSRARTRTMLLGGGASLAPEDDSTMMRAPSSPSSVRKPSPDPGPTSQQPCAQGP
SDCGKQCEPDYYRDGDGRCKACVTCSGDLVEKTPCTWNSSRVCECRAGMFCATSATNSCA
RCNPHSACPPGMVTKAQGAVERDATGESPPPEARPECSTNPEDSKAPTSATAPLVSSADP
QISKEHGGGITHAWGDTPISTSTPISFSSTGKPVLDSGSVLFWTVLVLVMVLGSVSFLLC
HRRACRKWIQQKLHLCYPVQTFRPKLEPVDSRPRRNLTQLKSISVVESGMGELGLMSPPA
VETPPNGAACLESMRLLEASPPAAGSPSSPRDLPEPRVTSEHTNNRIEKIYIMKADTVIV
GTVRTEVPEGRGLAGPAGPEFEEDLEVDHAPRFPEQETEPPLGSCGDVMFSVEEEGKEAP
LPMTVSEK
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgtgccccctccgcgcagtgctgggactgctgctcctgggggtgctgggagccttcccg
caggatggagttcggagggacacctgcaaggaaggccccaaccactcctacgacgagact
gctgggaggtgctgttaccgctgccccgtggggctgacctcgcagcagccgtgcgcacga
gggccatcggactgtgggaagcagtgcgagcccgactactacctggacggggacggccgc
tgcaaggcctgtgtgacctgtgctggagacgaacttgtggagaaggtgccgtgcgcaggg
aacgcctcccgcgtctgtgagtgtcggcctggtatgttctgtgtcacctcagccatcaac
tcctgtgcccgctgtgagccccactccacctgtgcaccagggatggtcgtccagttccgg
ggcacagcagagagggacaccgtctgtgaggcaccttccccagtgaccagccctgactgc
agcaccaaccccgaagcctgccaggctcccaccagcagcaccaccccccgggccgggccg
cttggttcttcctcagcaagctccagggccaggaccaggaccatgcttcttggagggggc
gcttccctcgctccagaagatgattccacaatgatgagggcccccagctctccctcctcg
gtgcggaagcccagtccagatccagggccgacctcgcagcagccgtgcgcacaggggcca
tcggactgtgggaagcagtgcgagcccgactactaccgggacggggacggccgctgcaag
gcctgtgtgacctgttctggagacctggtggagaagacgccgtgcacgtggaactcctct
cgagtctgcgaatgtcgagctggtatgttctgtgccacgtcagccaccaactcctgtgca
cgctgtaacccccactccgcctgcccgccagggatggtcaccaaagcccagggtgcggtc
gagagggatgccaccggtgagtcgcctccccccgaggcccgccctgagtgcagcaccaac
ccagaggacagcaaggcacccaccagcgccactgcccctctggtctcctcggcagacccc
cagatcagtaaggagcatggagggggcatcacccacgcctggggagacacccccatatca
acaagcacgcccatctctttctcttccacgggaaagcctgttctggattcggggtcggtg
ctcttctggacggttttggtcctggtgatggtcttgggctccgtgtccttcctcctgtgc
caccggagggcctgcaggaagtggattcagcagaagctccacctgtgctaccccgtccag
accttccggcccaagctggagcctgtggattccaggcccaggaggaacctgacacagctg
aagagcatatcggtggtggagtcgggcatgggagagttgggcttgatgagccccccggct
gtggagacaccccccaacggggcagcctgcctagagagcatgcggctgctggaagccagc
ccccctgctgctgggagcccctcatcccccagggacctccccgagccccgggtgacctcg
gagcataccaacaacaggatcgagaagatctacatcatgaaggctgacacggtgattgtg
gggaccgtgaggaccgaggtgcctgagggccggggcctggcggggccggcggggcccgag
ttcgaggaggatctggaagtggaccatgccccccgcttcccggagcaggagacagagccg
cctctgggcagctgcggggatgtcatgttctcagtagaagaggaaggaaaggaggccccc
ttgcccatgactgtctctgagaaatga

DBGET integrated database retrieval system