Ailuropoda melanoleuca (giant panda): 100474867 Help Entry 100474867         CDS       T01329                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml01522   Endocrine resistance aml04010   MAPK signaling pathway aml04024   cAMP signaling pathway aml04210   Apoptosis aml04380   Osteoclast differentiation aml04620   Toll-like receptor signaling pathway aml04657   IL-17 signaling pathway aml04658   Th1 and Th2 cell differentiation aml04659   Th17 cell differentiation aml04660   T cell receptor signaling pathway aml04662   B cell receptor signaling pathway aml04668   TNF signaling pathway aml04713   Circadian entrainment aml04725   Cholinergic synapse aml04728   Dopaminergic synapse aml04915   Estrogen signaling pathway aml04917   Prolactin signaling pathway aml04921   Oxytocin signaling pathway aml04926   Relaxin signaling pathway aml04928   Parathyroid hormone synthesis, secretion and action aml04932   Non-alcoholic fatty liver disease aml04935   Growth hormone synthesis, secretion and action aml05031   Amphetamine addiction aml05132   Salmonella infection aml05133   Pertussis aml05135   Yersinia infection aml05140   Leishmaniasis aml05142   Chagas disease aml05161   Hepatitis B aml05162   Measles aml05166   Human T-cell leukemia virus 1 infection aml05167   Kaposi sarcoma-associated herpesvirus infection aml05170   Human immunodeficiency virus 1 infection aml05171   Coronavirus disease - COVID-19 aml05200   Pathways in cancer aml05207   Chemical carcinogenesis - receptor activation aml05208   Chemical carcinogenesis - reactive oxygen species aml05210   Colorectal cancer aml05224   Breast cancer aml05231   Choline metabolism in cancer aml05235   PD-L1 expression and PD-1 checkpoint pathway in cancer aml05323   Rheumatoid arthritis aml05417   Lipid and atherosclerosis aml05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100474867 (FOS)    04668 TNF signaling pathway     100474867 (FOS)    04024 cAMP signaling pathway     100474867 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100474867 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100474867 (FOS)    04660 T cell receptor signaling pathway     100474867 (FOS)    04658 Th1 and Th2 cell differentiation     100474867 (FOS)    04659 Th17 cell differentiation     100474867 (FOS)    04657 IL-17 signaling pathway     100474867 (FOS)    04662 B cell receptor signaling pathway     100474867 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     100474867 (FOS)    04917 Prolactin signaling pathway     100474867 (FOS)    04921 Oxytocin signaling pathway     100474867 (FOS)    04926 Relaxin signaling pathway     100474867 (FOS)    04935 Growth hormone synthesis, secretion and action     100474867 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     100474867 (FOS)   09156 Nervous system    04725 Cholinergic synapse     100474867 (FOS)    04728 Dopaminergic synapse     100474867 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     100474867 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     100474867 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100474867 (FOS)    05207 Chemical carcinogenesis - receptor activation     100474867 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     100474867 (FOS)    05231 Choline metabolism in cancer     100474867 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100474867 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     100474867 (FOS)    05224 Breast cancer     100474867 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100474867 (FOS)    05170 Human immunodeficiency virus 1 infection     100474867 (FOS)    05161 Hepatitis B     100474867 (FOS)    05171 Coronavirus disease - COVID-19     100474867 (FOS)    05162 Measles     100474867 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     100474867 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     100474867 (FOS)    05135 Yersinia infection     100474867 (FOS)    05133 Pertussis     100474867 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100474867 (FOS)    05142 Chagas disease     100474867 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     100474867 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     100474867 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100474867 (FOS)    05418 Fluid shear stress and atherosclerosis     100474867 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100474867 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100474867 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:aml03000]     100474867 (FOS)    04131 Membrane trafficking [BR:aml04131]     100474867 (FOS) Transcription factors [BR:aml03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     100474867 (FOS) Membrane trafficking [BR:aml04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100474867 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  100474867 NCBI-ProteinID:  XP_002914750 Ensembl:  ENSAMEG00000027409 UniProt:  D2GZY0 LinkDB All DBs Position 14:15945200..15948632 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLSDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg ggctctcccgtcaatgcgcaggacttctgcacggatctggccgtctccagtgccaacttc atcccgacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggccccctcccagaccagagccccccacccctatggagtccctacc ccctccgctggggcttactccagggctggagtcgtgaagaccatgacgggaggcagagct cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggccgcagccaagtgccggaaccggaggagggag ctgactgacactctccaagcggagacagaccaactagaagatgagaagtctgctttgcag accgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcggctcac cgacctgcctgcaagatccccgacgacctgggcttccccgaagagatgtctgtggcttcc ctagatctgagcgggggcctgcccgaagccgccacccccgagtccgaggaggctttcacc ctgcccctcctcagtgatcctgagcccaagccctccgtggagcccgtcaagagcatcagc agcatggagctgaaggccgagccctttgatgacttcctgttcccagcgtcatccaggccc agcggctccgagaccgcccgctccgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagagctg gagcctctgtgcacccccgtggtcacctgtactcccagctgcactacctacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgctcaccgcaag ggcagcagcagcaacgaaccgtcctctgactcgctcagctcccccacgctgctggccctg tga

DBGET integrated database retrieval system