KEGG   Ailuropoda melanoleuca (giant panda): 109491336
Entry
109491336         CDS       T01329                                 
Name
(RefSeq) putative uncharacterized protein encoded by LINC00472 isoform X1
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04927  Cortisol synthesis and secretion
aml04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    109491336
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109491336
SSDB
Motif
Pfam: MRAP SelK_SelG
Other DBs
NCBI-GeneID: 109491336
NCBI-ProteinID: XP_034503778
LinkDB
Position
19:complement(23614483..23713610)
AA seq 187 aa
MRPGSGPARLRVRAPALPRPLFDRRSPRPAPSRPAWPPPGEGAPPRSRSREGSPSAAAEP
GNLRAGKSLRRLRGAARYGTARPWRPRSPPVTFWTRRQPGPRCGRRRLPGGPESVRGRPG
LRVSWPLGRDGFKLSGALGFGERIRRVPLVLFGASGENKYKCDCLRVADMPLAREPYRWE
PFRSRGY
NT seq 564 nt   +upstreamnt  +downstreamnt
atgcggccgggttccggccccgcgcgcctcagagtgcgggcgcctgcgctcccccggccc
ctatttgaccgtcgctcgcctcgcccagccccctcccggccggcttggcccccgcccggg
gaaggggcgccccctcgctcccgcagccgggaaggaagtccgtccgcggccgcagagccc
ggcaacttgcgagccgggaaaagtttgcggcgcctccgcggggcggcgcgatacggcacg
gcccgcccctggcgtccgcggtcaccgccggtgactttctggactcgtcgtcagcccggg
ccgcgatgcggccggcggcgactgccgggagggccagagtctgtccgagggcgcccgggg
ctgcgggtgagttggcctttggggcgcgatgggtttaagctgtctggggcacttgggttt
ggggagaggataaggagagtgcctttagtactttttggagcaagcggggagaacaaatat
aagtgcgattgcttaagagtcgctgacatgccgctggctcgtgaaccgtatcggtgggaa
ccttttaggagccggggctactga

DBGET integrated database retrieval system