KEGG   Amycolatopsis mediterranei S699: RAM_46840
Entry
RAM_46840         CDS       T01822                                 

Name
(GenBank) 1-aminocyclopropane-1-carboxylate oxidase
  KO
K21815  2-oxoglutarate dioxygenase / 2-oxoglutarate/L-arginine monooxygenase/decarboxylase [EC:1.13.12.19 1.14.20.7]
Organism
amn  Amycolatopsis mediterranei S699
Brite
KEGG Orthology (KO) [BR:amn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RAM_46840
Enzymes [BR:amn01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.19  2-oxoglutarate dioxygenase (ethene-forming)
     RAM_46840
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.7  2-oxoglutarate/L-arginine monooxygenase/decarboxylase (succinate-forming)
     RAM_46840
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-ProteinID: AEK47833
UniProt: G0FUM8
LinkDB
Position
complement(9980646..9981647)
AA seq 333 aa
MRTFELPVSVGGTTIDRILGKQLVRTWEDDGIFQVAATAEQARITGEALAESRRFFAGSL
PEKAKLVSDLTYSGYIASGEEVTAGEADYSEIFTVCPDIPLTDTRVTEGWPCHGPVPWPD
DGYRTAMEAHLREVGEIGEKLLKLVALGLGVEIDRLTRLTRDGWHHMRVLRFPARSATTE
RGIGAHTDYGLLVIAAQDDVGGLFIRPPVPGEPRLRNWLPEESTAGMYQDEPPWHFVEPE
PAVFTVFPGDILQFLTGGRLLSTPHKVRLGDRERYTLAYFHEPAFGVTVRPLAGGDESIH
YGTHFTNMFTRCYPDRVTTKRIHEEGRMRLLSQ
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgcgaacgttcgagctgcccgtttcggtgggtgggacgacaatcgatcggatattgggc
aaacagctggtccggacctgggaggacgacgggatcttccaggtcgccgccactgccgag
caggcccgcatcaccggtgaagcactcgccgaaagccggcggttcttcgccggctccctg
ccggaaaaagcgaaactcgtcagcgatctgacctacagcggctacatcgcttccggcgaa
gaagtgaccgcgggcgaagccgactattccgagatcttcacggtgtgcccggacatcccg
ctcaccgacacccgcgtcaccgagggctggccgtgccacggaccggtcccgtggccggac
gacggctaccggacggcgatggaggcccatctccgggaagtcggcgaaatcggcgagaaa
ctcctgaaactcgtcgccctcgggctgggcgtggagatcgaccggctgacgcggctcacc
cgggacggctggcaccacatgcgcgtgctgcggttcccggcccggtccgcgaccaccgaa
cgcgggatcggcgcgcacaccgactacggcctgctcgtgatcgccgcgcaggacgacgtc
ggcggcctcttcatccggccgccggtgcccggtgaaccgcggctccgcaactggctgccg
gaagaaagcacggccgggatgtaccaggacgaaccgccctggcacttcgtcgaacccgaa
ccggcggtgttcaccgtgtttcccggcgacatcctccagttcctgaccggcggccggctc
ctgtcgacgccgcacaaggtccggctcggggaccgggagcggtacacgctggcgtacttc
cacgagccggcgttcggcgtcaccgtccgcccgctggccggtggggacgaaagcatccac
tacggcacgcacttcacgaacatgttcacccggtgctacccggaccgggtgacgaccaag
cgcatccacgaggagggccggatgcggctgctcagccagtga

DBGET integrated database retrieval system