Anopheles moucheti: 128309594 Help Entry 128309594         CDS       T09615                                  Name (RefSeq) LIRP-like   KO K04526   insulin Organism amou  Anopheles moucheti Pathway amou04068   FoxO signaling pathway amou04081   Hormone signaling amou04140   Autophagy - animal amou04150   mTOR signaling pathway amou04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:amou00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     128309594    04150 mTOR signaling pathway     128309594   09133 Signaling molecules and interaction    04081 Hormone signaling     128309594  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128309594  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     128309594  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:amou04052]     128309594 Cytokines and neuropeptides [BR:amou04052]  Neuropeptides   Unclassified    128309594 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Toxin_32 Motif Other DBs NCBI-GeneID:  128309594 NCBI-ProteinID:  XP_052901988 LinkDB All DBs Position 2:70060170..70070077 Genome browser AA seq 133 aa AA seqDB search MRSIFVGMNSILIVAVVVLLLLNESKANSTPNSDALISQLTRSRYCGRRLTETLAFLCQG RYPMLTHYRTDYVHDQQNQRVKVEVATLPDTLPPGFPYPGAGVHRRSRRNSGGIYDECCK KSCSYVELRAYCD NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgcgatctatctttgtcggaatgaactccatcctgatcgtagcggtggttgtgctgttg ctgctgaacgaaagtaaagccaactccacgccgaacagcgatgccttgatcagtcagtta actcgctcacgctattgtggccgtcggcttacagagacgcttgccttcctctgccaggga cgatatccgatgctaacgcactaccgaaccgactacgtccacgatcagcaaaaccagcgg gtaaaggtagaagtagcaacgctgcctgatacactgccaccgggcttcccgtatcctggg gctggtgtgcaccggcgtagtcggcgcaattccggcggtatttacgatgagtgctgcaag aagagctgctcgtacgtcgagctgcgtgcgtactgtgattga

DBGET integrated database retrieval system