KEGG   Amycolatopsis sp. YIM 10: YIM_39185
Entry
YIM_39185         CDS       T06270                                 

Gene name
srfAA
Definition
(GenBank) Surfactin synthase subunit 1
  KO
K12743  N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase [EC:6.3.2.26]
Organism
amyy  Amycolatopsis sp. YIM 10
Pathway
amyy00311  Penicillin and cephalosporin biosynthesis
amyy01100  Metabolic pathways
amyy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amyy00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    YIM_39185 (srfAA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:amyy01008]
    YIM_39185 (srfAA)
Enzymes [BR:amyy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.26  N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase
     YIM_39185 (srfAA)
Polyketide biosynthesis proteins [BR:amyy01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   YIM_39185 (srfAA)
SSDB
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C Thioesterase
Other DBs
NCBI-ProteinID: QFU92989
UniProt: A0A5P9PX58
LinkDB
Position
complement(8249680..8260575)
AA seq 3631 aa
MTSARHLKSAADWCERIDAIAGQRCDLEMLLKDEWRHRVAVRDDGSGVRATQEQELVFAG
QDYTALKAALAAGVSLGAYALATLHSVLHAYGHGHQTVLAFLRDDRVLPVIVDHLDQAGL
TCAAAAEQIDDAVRRQDMYLAPPELLRRGLFDALLVLADRRLALTELPPSPLVTVVRDDP
AAGCLHWTISYAGEFFEDKIIAGVLDVVREVLGQFIGRPEQLVADIDLVSAEQELQLHQW
NGTDGEFDEDKRLNEIFEDVARRAPEREAVVCGEVSLTYREINERANQFAHWLLGAPVRV
EPEELIGLYLDKSDLGVVATFGIWKAGAAYVPIDPAYPAERIRFIVGDTGLSGIVTNSRH
AERLREVLGAEHASVHIIEIEAVMAAQHDEAARENPGLALSSRNRAYVTYTSGTTGVPKG
VPKYHYSVVNSITDLSERYDMRRPGTERVALFASYVFEPHLRQTLIALINEQTLVIVPDD
VRLDPDRFPEYIERYGVTYLNATGSVLQHFDLRRCPSLRKLLLVGEELTAAGLRRLRERF
PGHVVNEYAFTEAAFVTAIKEFAPGVTERRDRSIGRPLRNVKWYVLSQGLKQLPIGAIGE
LYIGGCGVAPGYLNRDDLTAERFTANPFQTEEEKARGRNGRLYRTGDLARVLLNGEVEFM
GRSDFQLKLNGVRVEPGEIEAQATEFPGVRKCVVVAKENATGDRHLVGYYIAEDSAEVAE
ADLLAFLEQRLIRIMVPARMVPMSSIPVNVNGKVDWRALPDVSVHDTGEHAPADGVTGRL
REIWSDVLGVPATRIGDGDDFFRLGGQSISCILLIARVRQRLGLSLGVEDVFALRTLGAL
AGYLEQQAHGAESAVAIEPVTTGSEPVRMLANGLQQGLLYHHLKTAGGDDAYVVQSVHHY
HAPIRPELMKDAWQLARQKYPALRLRFEWGDEPVQIVDNDDKPFDWRFVDLSASDDTEAR
IRELQERDRTEPYELAEGRLFRVYLIKQRDDLFSLIFSCHHIILDGWSLPVLHDEVHRGY
LALLAGRPAESDVDNAYVAAQRYWEAHRNDHAAYWVEQIGRIDERGDFAGLLNERSRYRV
SLADYDHVRQHRTRKLCLGAELTGALKAGCAADQVTLHSVLQFVWHKVLHAIGGGNTTVV
GTIVSGRNLPVDGIEHSAGLYINTLPLIVDHDEQAGRSVAEAVRDIQATVNTMNTKSIVE
LGRLQSGEMKRRLFDTLLVLENYPRLLDEAEEREHQELLRFEKAYDADKVDYPIAVVARE
EGDELTVTLWYAGELFDEDTIDTLLEVARTLFCQVSENISRPVRDLDLVSPAMLARFDSW
NETAEDFPADRTLHAVFEEMAARWPDEIAVVYRENRLTYRELNERANRLAHYLRSVVELR
PDDLVALVLDKSELMITAIIAAWKTGAAYVPIDSGYPDDRISFMLEDTRARLVVTNEIHS
ERLRSLPGAESRYVLEIELLHLDDQPATNPVTETTSTDLAYAIYTSGTTGKPKAVLVEHR
GVVNLQVSLAKLFDLGKENRDEALLSFSNYIFDHFVEQMTDALLNGQKLVVLDDSMRTDP
ERLCRYLNDEQVTYLSGTPSVLSLYDYSTATSLTRIDAIGEDFTEPVFSKIRGTFPGLII
NGYGPTEISITSHKRPYPPDVHRVNKSIGFPVANTKCYVLNKAMKPVPVGGIGELYIGGI
GVTRGYLNREDLTADRFLDNPFQSPEEARLGENGRIYKTGDLVRRLPNGEVEYLGRTDLQ
VKIRGQRVELGEVEAALSSYPGVVRSLVVAREHTVGQKYLVGFYVGEQEFDEQDLKQWMR
GKLPESVVPARILRITDIPVTPSGKLDARRLPETDFGAGESAEYVAPVSEFELKLCGIWS
QVLEIAPDRIGVHDDFFALGGDSIRAMALAQAITTGFGQGLGVATVLQHTTLAAQAEHIQ
AASLEHTAWTPLPAAAEHPPVSLAQERLLFIDDFEGGTAAYNIPFALRLPAKDQDAIPGA
LAALVRRHPALRTLLKTDEQGVRRQFVIPADEVRIDVPLTTVDSAAKLDEVLVEHAAHVF
RLHEELPIRAEVVEFADEPHLSVVVHHTCFDGWSWDLFRRELAALLDGTELEPLRGTYGD
FAVWQRQYLTGKRLSSLTEFWTGALGGFETIALPLDRPRPPRFDYRGRELEFELDERTTE
ALRELARTARVSLYSVLLGAWCVMLNMYTGQHDLVIGTPSANRGRPEFDRTIGFFANLLA
LRVRVDPAATVPAYVRSVGEAVVAAQVHGELPFEQLVKELAVEKDPSRHPILQVNFTLQN
VSDHTSALTEYKPDAGGWTTTKFDLSATLTETATGLAGNLTYAAALFDDTSAGGFIATFK
HVLSEFISAAAQTPVAELTALDSRGQAALLTPPDEPATQQTRTLHAVFEEMAAAWPDEIA
VVHGDARLTYRELNERANRLAHHLRSWAGLRPDDLVGLVLDQTELTVVAILAVWKAGAAY
LPIDPGYPDDRIAFMLSDTGAKLVLAGAAHGSRVRGLSSARVLDLEQLELHHESPENPVT
ETTSTELAYAIYTSGTTGRPKAVLVSHGSVDSFRAQLSGRYFGTPDQTREAVLFLANYVF
DFSVEQLALSVLGGHKLIVPPPSAADDPAFYELANREGLSYLSGTPTQVQRFDLTRLTRL
RCVLVAGEAFQPQHFDKIRGEFDGPILNAYGTTETTVYNTVHRFEPGDPHRNTLGAPLGN
TRLYVLGDGLKLLPTGAVGELYLAGECVTEGYLHRPELTRERFLPNPFPAESGRYPMIYR
TGDVVRRGPDGEIQYLGRNDAQVKINGLRIEPGEVEAVLAGCPGVRQCAVLAGADPRAPE
RKRLVGYYLPEPGASVDESDILAVLRAQLMPSMVPSPLVRLDRPLPMTITGKLDVDALPS
ADFSPKRAAYAAPRDRVEARLCQLWSAQLPGGSVGIDDDFFRSGGDSISALHLASQVQRE
IERKVSVKYIFDYPTVRQFADNVLSGPADTGGTDEPEQGRLTGECPMLPIQEWFFAKPLA
DRHRWNHNFAIQTPPLDTGKLRAAMDRLVDHHDAFRLRFPETGGQFYAENAPSITVHELD
VREIADLQRQLIDWQSEFDLADGPTACAAYLHGFDDGTARIWFAMHHLVVDTVSWHILAQ
DLEILYNGGDLGAKTGSYRQWATAVREYTPHEDERRFWADTTRDMESPELLAQTEGSTRR
REEFALTAEHTRTLLADSPWAYDTEVNDLLLTATGFALRSITRQATNHLTVEGHGRELFD
GAPDVRDTVGWFTTMHPFAVEVDPGDLGRSVLATKASRRRIPHHGIGYGALFAGRAPLPA
VSFNYLGRLSDAEAEPTEAWRLDPAMSGSHTVNGNRAANRSSIDVTMSCTGGRLVAVVDS
LLGEAATRMFASELKVWLERLIAHTATVARNEPARETGTELFDPYILVNEEAEQTLFVLP
PGEGGAESYLSNLARELPEHRLVLFNNVHLHSPMGSFEELGRYYVEHLRRLQPSGPYHLL
GWSFGGVLSLEISRQLARAGERIADLLLIDPYFGMRQASASIGLPEVEDILDPINYHYQP
DEADLARLADRLGRLLLFKAGELNDVVHGPHQPRLFEFYQGTHYNNLDLLLPAEAIEIQV
LEGETHHSWVRNTKLVKAMCERISSSPGRNS
NT seq 10896 nt   +upstreamnt  +downstreamnt
atgacgtcagcacgacacctgaagtcggccgcggactggtgcgagcgcatcgacgcgatc
gccggtcagcgctgcgacctggagatgttgctcaaggacgagtggcggcaccgggtcgcc
gtccgcgacgacggctccggtgtccgcgccacccaggagcaggaactggttttcgccggt
caggactacaccgcgctgaaggcggcgctggccgccggggtctcgctcggcgcctacgca
ctggccaccctgcacagcgtgctgcacgcctacgggcacggccaccagacggtgctcgcc
ttcctccgggacgacagggtgctcccggtcatcgtcgaccacctcgaccaggccgggctg
acctgcgccgcggccgccgagcagatcgacgacgcggtgcggcggcaggacatgtacctc
gcgccgccggagttgttgcggcgcggccttttcgacgcgctgctcgtgctcgccgatcgg
cgcctggcgctcaccgagctaccgccgtccccgctggtgacggtcgtacgggacgacccg
gcggccggttgcctgcactggaccatctcgtatgccggcgagttcttcgaggacaagatc
atcgcgggtgtgctcgacgtcgtgcgcgaggtgctcggccagttcatcggccgccccgag
cagctcgtcgccgacatcgacctggtctcggcggaacaggaactccagctgcaccagtgg
aacggcaccgacggcgagttcgacgaggacaagcggctcaacgagatcttcgaggacgtg
gcccggcgcgcgccggaacgcgaagccgtggtctgcggtgaagtcagcctgacctaccgc
gagatcaacgagcgcgccaaccagttcgcccattggctcctcggcgcgccggtgcgcgtg
gagcccgaggaactgatcggcctctacctcgacaagagcgatctgggcgtggtcgccacc
ttcggcatctggaaggcgggcgcggcctacgtcccgatcgatccggcctatcccgccgaa
cgcatccgcttcatcgtcggcgacaccgggctttccggcatcgtgacaaacagcaggcac
gccgagcgcctccgcgaagtgctcggcgccgagcacgcctcggtgcacatcatcgagatc
gaagcggtgatggccgcgcagcacgacgaggccgcccgcgagaacccgggcctggcgctc
agcagccggaaccgcgcgtacgtcacctacacctcgggcaccaccggtgtgcccaagggc
gtgccgaagtaccactacagcgtggtcaacagcatcaccgacctctccgagcgctacgac
atgcgccgtcccggcaccgaacgcgtcgcgctcttcgcctcctacgtgttcgagccgcac
ctgcgccagacgctgatcgcgctgatcaacgagcagaccctggtgatcgtgcccgacgac
gtccggctcgatcccgaccgcttccccgaatacatcgagcgctacggcgtcacctatctc
aacgccaccggctcggtgctccagcacttcgacctgcggcggtgcccgagcctgcggaaa
ctgctgctggtcggcgaggagctgaccgcggccgggctgcggcggctgcgcgagcggttc
cccggccacgtcgtcaacgagtacgccttcaccgaggccgcctttgtcaccgcgatcaag
gagttcgcgccgggggtgaccgagcgccgcgaccgcagcatcggcaggccgctgcgcaac
gtcaagtggtacgtgctcagccaagggctcaagcagctgccgatcggcgccatcggcgag
ttgtacatcggcggctgcggggtcgcgcccggttacctcaaccgggacgacctgaccgcc
gagcgcttcacggcgaacccgttccagaccgaggaagagaaggcacgcggacgcaacggc
aggctctaccggaccggcgacctcgcgcgggtgctgctgaacggtgaagtcgagttcatg
ggccgcagcgacttccagctgaagctcaacggcgtccgcgtcgagccgggggagatcgag
gcgcaggccaccgagttccccggcgtgcgcaagtgcgtggtggtggccaaggagaacgcc
accggcgaccgccacctcgtcggttactacatcgccgaggactcggcggaggtggccgag
gccgatctgctggctttcctcgaacagcggctcatccggatcatggtgccggcgcgcatg
gtgccgatgtcgagcattccggtcaacgtcaacggaaaggtggactggcgcgccctgccg
gacgtcagcgtccacgacaccggggagcacgcgcccgccgacggcgtcaccggccggctg
cgggaaatctggagcgacgtgctcggtgtcccggccacccggatcggcgacggcgacgac
ttcttccgcctcggcggtcagagcatctcgtgcatcctgctgatcgccagggtgcggcag
cggctcggcctctccctcggggtggaggacgtgttcgcgctgcgcacgctgggcgcgctg
gcgggttacctggaacagcaggcacacggcgccgaatcggcggtcgcgatcgaaccggtc
accaccggcagcgagccggtccgcatgctcgcgaacgggttgcagcaaggcctgctctac
caccacctgaagaccgcgggcggcgacgacgcgtacgtggtgcagtcggtgcaccactac
cacgcgcccatccgcccggaactgatgaaggacgcctggcagctcgcccggcagaagtac
ccggcactgcggttgcgcttcgaatggggcgacgagcccgtccagatcgtcgacaacgat
gacaagccgttcgactggcgctttgtcgacctgagcgcgtccgacgataccgaagcgcgg
atccgtgaattgcaggaacgcgaccgcaccgagccctacgaactggccgagggccgcctc
ttccgcgtctacctgatcaagcagcgcgacgacctgttctcgctgatcttcagctgtcac
cacatcatcctggacggctggagcctgccggtgctgcacgacgaggtgcaccgcggttat
ctcgccctgctcgccgggcggcccgccgagtccgatgtggacaacgcgtacgtggcggcc
cagcggtactgggaggcgcaccgcaacgaccacgccgcctactgggtcgagcagatcggc
cggatcgacgaacgcggtgacttcgccgggctgctcaacgagcgcagccggtaccgggtc
tcgctggccgactacgaccacgtccggcagcaccggaccaggaagctctgccttggggcg
gagctgaccggcgcgctcaaggcgggctgtgccgccgaccaggtgaccctgcactcggtg
ctgcagttcgtctggcacaaggtgctgcacgccatcggcggcggcaacaccaccgtggtc
ggcaccatcgtgtccggccgcaacctgccggtcgacggcatcgagcactccgccgggctg
tacatcaacacgctgccgctgatcgtcgaccacgacgagcaggccggccgcagcgtcgcc
gaggcggttcgcgacatccaggccacggtgaacacgatgaacaccaagagcatcgtggaa
ctgggcaggctgcagagcggtgagatgaagcgccgcctgttcgacacgctgctggtgctg
gagaactacccgcgcctgctggacgaggcggaggagcgggagcaccaggagctgctgcgc
ttcgagaaggcctacgacgccgacaaggtcgactacccgatcgccgtggtggcgcgggaa
gagggcgacgagctgaccgtcaccctgtggtacgcgggcgaactgttcgacgaggacacc
atcgacaccctgctcgaagtcgcgcggacgttgttctgccaggtgtccgagaacatctcg
cgcccggtccgcgacctggacctggtctccccggcgatgctcgcgcggttcgactcgtgg
aacgaaacggccgaggacttccccgcggacaggacgttgcacgcggtgttcgaggaaatg
gccgcacgctggccggacgagatcgcggtggtgtaccgcgagaaccggctgacctaccgc
gagctgaacgaacgggccaaccgcctggcgcactacctgcgctcggtggtcgagctgcgg
ccggacgacctcgtcgcgctggtgctggacaagagcgaactgatgatcaccgcgatcatc
gccgcctggaaaaccggcgccgcgtacgtgccgatcgactccggttatcccgacgaccgg
atctcgttcatgctggaagacacccgggctcgcctggtggtgaccaacgagatccacagc
gaacggctgcgttcgctgcccggcgcggaatcccggtacgtgctggagatcgagctgctg
cacctcgacgaccagcccgcgaccaacccggtcaccgaaacgaccagcaccgatctcgcc
tacgcgatctacacctcgggcaccaccgggaagcccaaggccgtgctcgtcgaacaccgg
ggcgtggtcaacctccaggtgtccctggcgaaattgttcgatctgggcaaggaaaaccgg
gacgaggcgctgctgtcgttctcgaactacatcttcgaccacttcgtcgagcagatgacc
gacgcgctgctcaacgggcagaagctggtggtgctcgacgacagcatgcgcaccgatccg
gaacgcctctgccggtacctgaacgacgagcaggtcacctacctttccggtacgccgtcg
gtgctttcgctgtacgactactccacggcgacttcgctgacgcgcatcgacgcgatcggc
gaggacttcaccgagccggtgttcagcaagatccgcggcaccttccccggcctgatcatc
aacgggtacgggccgacggagatctcgatcaccagccacaaacggccctacccgccggac
gtgcaccgggtgaacaagagcatcggcttccccgtcgccaacaccaagtgctacgtgctg
aacaaggcgatgaagccggtgccggtcggcgggatcggcgagctgtacatcggcggaatc
ggcgtgacacggggttatctcaaccgcgaggacctgaccgccgaccgcttcctggacaac
ccgttccagtcgccggaggaagcgcggctcggcgagaacggccgcatctacaagaccggt
gacctggtgcgccggctgcccaacggtgaggtggagtacctcggccgcaccgatctccag
gtcaagatccgcggtcagcgcgtggaactcggcgaggtggaggccgcgctttcctcgtac
cccggcgtggtccgctcgctggtggtcgcccgcgagcacacggtggggcagaagtacctg
gtcgggttctacgtcggtgagcaggagttcgacgagcaggacctgaagcagtggatgcgc
gggaagctgcccgaatccgtggtgcccgcgcgcatcctgcggatcaccgacatcccggtg
accccgagcgggaagctggacgcgcgaaggctgccggaaacggacttcggagccggtgag
agcgccgagtacgtcgcgccggtcagcgagttcgagctgaagctgtgcggtatctggtcg
caggtgctggagatcgccccggaccgcatcggcgtgcacgacgacttcttcgcgctcggc
ggcgacagcattcgcgcgatggcgctggcgcaggcgatcaccaccggcttcggccagggt
ctcggtgtcgccaccgtgctccagcacacgacgctcgccgcgcaggccgagcacatccag
gccgcctcgctcgagcacacggcgtggaccccgctgccggcggcggccgagcacccgccg
gtctcgctcgcgcaggaacgcctgctgttcatcgacgacttcgagggcggcaccgcggcc
tacaacatcccgttcgcgctccggctgcccgcgaaggaccaggacgcgatcccgggtgcg
ctggccgcactcgtccgtcgccaccccgccttgcgcacgctgctcaagaccgatgagcag
ggcgtgcgacggcagttcgtcatcccggcggacgaggtgcgtatcgacgtcccgctgacc
acagtggacagtgcggcgaaactggacgaagtactggtcgagcacgccgcccacgtgttc
cgcctgcacgaggaactgcccatccgcgccgaggtcgtcgaattcgccgacgagccgcac
ctgagcgtcgtggtgcaccacacctgcttcgacggctggtcgtgggacctgttccgccgc
gaactggcggcactgctggatggcaccgaactcgaaccgctccgcggcacgtacggcgat
ttcgccgtgtggcagcggcagtacctgaccggcaagcgcctgtcctcgctgaccgagttc
tggacgggtgcgctcggcgggttcgagacgatcgccctgccgctggaccgcccgcgcccg
ccgcgcttcgactaccgcggccgtgagctggagttcgagctggacgagcggaccaccgaa
gcgctgcgcgagctggcccgcacggcacgggtgagcctgtacagcgtgttgctcggcgcg
tggtgcgtgatgctcaacatgtacaccgggcagcacgacctggtgatcggcacgccgtcg
gcgaaccgcggccgtccggagttcgaccgcaccatcggcttcttcgcgaacctgctggcg
ttgcgcgtccgtgtcgacccggcggcgaccgtgcccgcgtacgtgcgctcggtcggtgag
gccgtggtcgccgcgcaggtgcacggtgaactgccgttcgagcagctggtcaaggaactc
gcggtggagaaggacccgagccggcacccgatcctgcaggtcaacttcaccctgcagaac
gtctcggaccacaccagcgcgctgaccgagtacaagccggacgccggtggctggaccacc
acgaagttcgacctgtcggcgacgctgaccgaaaccgcgaccgggctcgcgggcaatctc
acctacgccgccgcgctgttcgacgacaccagcgccggcgggttcatcgccaccttcaag
cacgtactgagcgagttcatctcggccgcggcgcagaccccggtcgccgaactcaccgcg
ctcgactcgcgcggccaggcggccctgctgacgccgcccgacgagcccgcgacccagcag
acccggaccctgcacgcggtgttcgaggagatggccgcggcctggcctgacgaaatcgcc
gtggtccacggtgacgcgcggctgacctaccgcgagctgaacgaacgggccaaccgactc
gcgcaccacctgcgttcttgggccggcctgcggccggacgacctcgtcgggctggtgctg
gaccagaccgagctgaccgtcgtcgcgatcctcgcggtgtggaaggcgggcgcggcctac
ttgccgatcgatcccggctatcccgacgaccggatcgcgttcatgctgtcggacaccggc
gcgaagctggtgctcgccggtgcggcccacggttcgcgggtgcgcgggctgtcttcggcg
agggtgctggacctcgagcaactggaactgcaccacgagtcgccggagaacccggtcacc
gagaccacgagcaccgagctggcctacgcgatctacacctccggcaccacgggcaggccc
aaggcggtgctcgtctcgcacggttcggtcgacagcttccgcgcgcagctgagcggccgc
tacttcggcacgcccgaccagactcgcgaagccgtgctgttcctggcgaactacgtgttc
gacttctccgtcgagcagctggcgctgtccgtgctcggcgggcacaagctgatcgtgccg
ccgccatcggccgccgacgacccggcgttctacgagctggcgaaccgcgaggggctgagc
tacctcagcggcacgccgacccaggtgcagcgcttcgacctgacccggctgacgcgcctg
cgctgcgtgctcgtcgcgggggaggcgttccagccgcagcacttcgacaagatccgcggt
gaattcgacggcccgatcctcaacgcctacggcaccaccgaaaccaccgtgtacaacacc
gtgcaccgcttcgagcccggcgatccccaccggaacacgctcggcgcgccgctcggcaac
acgcggctctacgtgctgggtgacgggttgaagctgctgccaacgggcgcggtcggtgag
ctgtacctggccggcgaatgcgtcaccgagggatacctgcaccggccggagctgaccagg
gagcggttcctgccgaacccgttcccggccgagtccggccgttatccgatgatctaccgg
accggtgacgtggtccggcgcggtccggacggtgagatccagtacctgggccgcaacgac
gcccaggtgaagatcaacgggctgcggatcgagcccggtgaggtcgaggccgtgctggcc
gggtgccctggcgtgcgccagtgcgcggtgctcgccggcgcggatccgcgggcgccggag
cgcaagcggctcgtcggttactacctgcccgagccgggcgcgtccgtcgacgaaagcgac
atcctcgccgtgctgcgcgcgcagttgatgccgagcatggtgccgtcgccgctggtgcgg
ctcgaccggccgttgccgatgacgatcaccggcaagctggacgtcgacgccctgcccagc
gcggacttctcgccgaagcgcgcggcctacgcggcgccccgcgatcgcgtcgaggcgcgg
ttgtgccagctgtggagcgcgcagttgccgggtggttcggtcggcatcgacgacgacttc
ttccgctcgggcggggacagcatcagcgccctgcacctggcgagccaggtccagcgggag
atcgaacgcaaggtcagcgtcaagtacatcttcgactacccgaccgtgcggcagttcgcc
gacaacgtgctctccggcccggccgacaccggcggcaccgacgagcccgaacagggccgc
ctgaccggcgagtgcccgatgttgcccatccaggagtggttcttcgccaagcccctggcc
gaccggcaccgctggaaccacaacttcgcgatccagacgccgccgctggacaccgggaag
ctgcgtgccgcgatggaccggttggtcgaccaccacgacgccttccggctgcgcttcccg
gaaaccggcggtcagttctacgcggagaacgccccgtccatcaccgtgcacgaactcgac
gtgcgcgagatcgccgacctccagcggcagctgatcgactggcagagcgagttcgacctg
gccgatggaccgaccgcctgcgcggcctacctgcacggcttcgacgacggcaccgcgcgg
atctggttcgcgatgcaccacctcgtggtcgacacggtcagctggcacattctggctcag
gacctggagatcctgtacaacggcggcgacctcggcgcgaagaccggcagctaccgccag
tgggccacggccgtgcgcgagtacaccccgcacgaggacgaacgccggttctgggcggac
accacgcgggacatggagtcgccggaactgctggcgcagaccgaggggagcaccaggcgt
cgcgaggagttcgcgctcaccgccgagcacacccggaccctgctcgcggacagcccgtgg
gcctacgacaccgaggtcaacgacctgctgctgaccgcgaccggcttcgcgctgcggtcg
atcacccgccaggcgacgaaccacctcaccgtcgagggccacggccgcgaactgttcgac
ggcgcgccggacgtgcgggacacggtcggctggttcaccaccatgcacccgttcgccgtc
gaagtggatcccggcgatctcgggcgcagcgttctcgccaccaaggcgagccggcggcgg
atcccgcaccacggcatcggctacggcgcgttgttcgctgggcgggcaccgcttcccgcg
gtcagcttcaactacctcggcaggctgagcgacgccgaggcggaaccgaccgaggcgtgg
cggctcgacccggcgatgtcgggcagccacacggtgaacggcaaccgcgcggcgaaccgg
tccagcatcgacgtgacgatgagctgcaccgggggccggctggtcgcggtggtcgacagc
ctgctcggtgaggccgccacccggatgttcgccagcgagctgaaggtctggctggaacgg
ctgatcgcgcacaccgcgaccgtcgcccgcaacgaaccggcccgcgaaaccggcaccgag
ctgttcgacccgtacatcctggtgaacgaggaagccgagcagacgctttttgtgctgccc
ccaggcgaaggcggcgcggagagctacctgagcaacctcgcgcgcgagctgccggagcat
cggctcgtgttgttcaacaacgtgcatctgcactctcccatgggttcgttcgaggagctg
ggccgctactacgtcgagcacctccggcggttgcagccgtccgggccgtaccacctgctc
ggctggagcttcggcggtgtgctgtcgctggagatctcccggcagctcgcgcgggcgggg
gagcggatcgccgacctgctgctgatcgatccgtacttcggcatgcggcaggcgtcggcg
agcatcggcctgcccgaggtcgaggacattctcgacccgatcaactaccactaccagccc
gacgaggcggacctcgcacggctcgccgaccggctcggccggctgctgttgttcaaggcg
ggcgagctgaacgacgtggtgcacggcccgcaccagccgcggttgttcgagttctaccag
gggacgcactacaacaacctcgacctcctcctgcccgccgaagcgatcgagatccaagtg
ctggaaggggaaacgcaccattcgtgggtgcgcaacacaaagctggtgaaggccatgtgc
gagcggatttcgtcgagtccagggagaaattcatga

DBGET integrated database retrieval system