KEGG   Amycolatopsis sp. YIM 10: YIM_43870
Entry
YIM_43870         CDS       T06270                                 

Gene name
aam4
Definition
(GenBank) Acylamidase
  KO
K19795  ureidomalonase [EC:3.5.1.95]
Organism
amyy  Amycolatopsis sp. YIM 10
Pathway
amyy00240  Pyrimidine metabolism
amyy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amyy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    YIM_43870 (aam4)
Enzymes [BR:amyy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.95  N-malonylurea hydrolase
     YIM_43870 (aam4)
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: QFU93908
UniProt: A0A5P9PZS6
LinkDB
Position
9441848..9443221
AA seq 457 aa
MSLVELDAVELAEKIRLREVSCTEVMAAYLDRIEEHNPRLNAIVALRDRGELMREAAERD
SEPYRGWLHGFPLAVKDLSAAAGLPWTFGSPVFADQIAEHDDLFVRRMKDAGGIVIGKTN
VPEFGLGSQTYNPVYGPTRNPFDHSRTPGGSSGGAAAAVASRMLPVADGSDYLGSLRNPA
AFTNTYGFRPSLGRVPSTSFVAQLDTAGPMGRTVADVAALLSVQAGPDPRAPLGIAEDPS
MFMPPLTPRDFRGTRIAWVGDFDGYLPMDPGVLDVCRGVFAGFTELGCEVVDAVPDYPMD
RVWRAVLTWRGFNVAANLGSLYRMPRDQLKPELVWELEQGLALSAADLGPASLERTRWLD
ALLRFFEDFDFILAPSAQVFPFDVDTPWPSTVGGREMDTYHRWMETVAPWSLAGVPVLGM
PAGFNSDGLPMGVQLIGKPRADLDVLTLADMLLPAEA
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgagcctggtcgaactcgacgcggtggagctggccgagaagatccggcttcgcgaggtg
tcgtgcaccgaggtgatggccgcatacctggaccggatcgaggagcacaacccacggctc
aacgcgatcgtcgcgctgcgtgatcgtggcgagctgatgcgggaagccgccgaacgggac
agcgagccgtaccgcggttggttgcacgggttcccgctggcggtgaaggacctctcggcc
gcggccggactgccgtggacgttcgggtcgccggtgttcgccgatcagatcgccgagcac
gacgacctcttcgtgcggcggatgaaggacgcgggcggcatcgtcatcggcaagacgaac
gtgcccgaattcgggctcggctcgcaaacgtacaacccggtgtacgggccgacgcggaac
ccgttcgaccattcgcgcacgccgggcggcagcagcgggggcgccgcggcggcggtcgcg
tcgcggatgctgccggtcgccgacggcagcgactacctcggttcgctgcgcaacccggcg
gcgttcaccaacacctacggattccggccgtcgctggggcgcgtgccgtcgacctcgttc
gtggcgcaattggacacggccgggccgatgggccggaccgtcgccgacgtcgccgcgctg
ctgtcggtgcaggccgggccggatccgcgtgccccgctgggcatcgccgaggacccgtcg
atgttcatgccgccgctgaccccgcgcgacttccgcggcacgcggatcgcctgggtcggg
gatttcgacgggtacctgccgatggaccccggcgtgctggacgtctgccggggcgtgttc
gccgggttcaccgagctgggctgcgaggtggtcgacgcggtgccggactacccgatggac
cgggtgtggcgggcggtgctgacctggcgcgggttcaacgtcgcggcgaatctggggtcg
ctgtaccggatgccgcgggatcagctgaagccggagttggtgtgggaactcgagcaggga
ctcgctttgtccgctgccgacctcggcccggcttcgctggagcgcacgcgatggctggac
gccctgctgcggttcttcgaagatttcgacttcatcctggcgccgagcgcgcaggtgttc
ccgttcgacgtcgacaccccgtggccgtcgaccgtcggcgggcgcgagatggacacgtac
caccggtggatggagaccgtggcgccgtggtcgctggccggggtcccggtgctgggcatg
ccggccggcttcaactccgacggcctccccatgggcgtccagctgatcggcaaaccccgc
gccgacctggacgtcctcaccctcgccgacatgcttttgcccgcagaagcatga

DBGET integrated database retrieval system