KEGG   Aspergillus niger: ANI_1_2092064
Entry
ANI_1_2092064     CDS       T01030                                 
Symbol
An07g08930
Name
(RefSeq) cytochrome P450 55A3
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
ang  Aspergillus niger
Pathway
ang00910  Nitrogen metabolism
ang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    ANI_1_2092064 (An07g08930)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ang00199]
    ANI_1_2092064 (An07g08930)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     ANI_1_2092064 (An07g08930)
Cytochrome P450 [BR:ang00199]
 Cytochrome P450, fungi type
  CYP55 family
   ANI_1_2092064 (An07g08930)
SSDB
Motif
Pfam: p450 zf-TFIIB
Other DBs
NCBI-GeneID: 4982161
NCBI-ProteinID: XP_001391967
LinkDB
AA seq 416 aa
MSQANTSAYNFPEDLPMYPFARPPKSYDPPAELAELRHQGPTERVQLFDGRPAWIVTRDK
EVREMLSSDKFSNDRYNRDGYPEIHSGTKKDGVRPTFVHMDDPKHARHRAMTESFFTQEA
TEAVKPQVQEVVDSLIDSIKERGCNNGPIDLVKELATVVNPKVILLSILKVSEKEANELI
QSSSALGGTSGSASESGHTDLHEYISQLIDARIEKPRRPQDDLLSKLVVDEYRQANLDRD
DLINLVYMIFVAGNSAIQSSIVLGVITLLQHQDQLEELKENPELAGRVVEEILRYHTPSA
LNSRRVTTTDITLGGKKIKSGSGVIGSVRSANRDERVYPDADKFSIHRQVDPHQNLAFGH
GPHNCQGQWLSRMELQAIFSSLFRKLPNLRLAIEPSELEYTSPTQNVGVLRLPVVF
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgtcccaagccaacacttccgcttacaatttccccgaagacttaccaatgtatcccttt
gctcgtcctccaaaatcatatgatccgcccgctgaattagcagagcttagacatcagggt
cccactgaaagggtccagcttttcgatgggagaccagcgtggatcgttactagggacaaa
gaggttcgtgagatgttgagcagtgataaattctccaatgaccgatacaatcgtgatgga
taccccgagattcatagtggtacgaagaaagacggggtcaggccaacgttcgtccacatg
gatgatccgaaacacgcgaggcacagagctatgacggagagctttttcacccaggaagcg
actgaagcagtcaaaccacaggttcaggaagtcgtggactcgttgatcgactcaatcaaa
gaacgaggctgtaacaatggccctatcgacctcgtcaaagagcttgccacagtagttaac
ccaaaggttatcttactgtccattctgaaagtctccgaaaaggaagccaatgagcttatc
cagtcgagctccgcgctcggcggcacaagcggatcggcgtctgagtctggccatacagac
ttgcacgaatacattagccaattgattgatgcgcgaatagagaaacctcgcaggccacaa
gatgacctgcttagcaagctcgtggtggacgagtatagacaagcgaacctcgaccgagac
gaccttatcaatcttgtctatatgatcttcgtggctgggaattcggcgattcaaagttcc
attgtcctgggcgttattactttgcttcaacaccaggatcagctcgaggagctcaaggag
aatcctgaactagcggggcgagttgttgaggagatcttgagatatcatactccatctgct
ctaaatagcagacgtgtcacaacaactgatatcacgcttggtgggaagaaaatcaaatcg
ggttccggggtcatcggctccgtgcgatccgcaaaccgcgatgaaagggtgtacccagat
gcagacaagttcagcatccaccgtcaagttgacccgcatcaaaacctggcattcgggcat
ggcccgcataactgtcaggggcagtggctctcccggatggagttgcaggccatcttcagc
tccctattccgcaagcttccgaacctacggctggcgattgagccttctgaactggaatat
acttcgccaacgcaaaatgttggggttctacgacttcctgtggtattttga

DBGET integrated database retrieval system