KEGG   Aspergillus oryzae: AO090026000019
Entry
AO090026000019    CDS       T01018                                 
Name
(RefSeq) unnamed protein product; dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
  KO
K24856  NADPH-dependent reductase
Organism
aor  Aspergillus oryzae
Pathway
aor00254  Aflatoxin biosynthesis
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AO090026000019
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Peripla_BP_6 DUF374 DUF664 THF_DHG_CYH_C 2-Hacid_dh_C Peptidase_M17_N
Other DBs
NCBI-GeneID: 5993549
NCBI-ProteinID: XP_001821521
UniProt: Q2UFZ6
LinkDB
Position
3:complement(5065046..5065945)
AA seq 262 aa
MSDNHRLDGKVALVTGAGRGIGAAIAVALGERGAKVVVNYAHSREAAEKVVEQIKANGTD
AIAIQADVGDPEATAKLMAETVRHFGYLDIVSSNAGIVSFGHLKDVTPEEFDRVFRVNTR
GQFFVAREAYRHMREGGRIILTSSNTACVKGVPKHAVYSGSKGAIDTFVRCMAIDCGDKK
ITVNAVAPGVIKTDMFLAVSREYIPNGETFTDEQVDECAAWLSPLNRVGLPVDVARVVSF
LASDAAEWVSGKIIGVDGGAFR
NT seq 789 nt   +upstreamnt  +downstreamnt
atgtccgacaaccaccgtttagatggaaaagtggccttggtgacaggcgccggccgcggc
atcggtgctgctatcgccgtcgcccttggtgagcgcggagccaaagtcgtggtgaactac
gcccattcccgtgaggccgcggagaaagtggttgaacagatcaaggccaatggtaccgac
gctatcgcaatccaggccgatgtcggggatcctgaggcgacggcgaagttaatggcggag
acggtgcgccattttggctacctggacatcgtgtcatcgaacgctggaattgtatcgttc
ggtcacctgaaagacgtgaccccagaagaatttgaccgggtcttccgggtcaacacccgt
ggccagttcttcgtggcgcgggaggcctatcgccatatgcgggaaggaggccggattatc
ctgaccagctctaacactgcttgcgtgaagggggtccccaagcatgctgtatactccggg
tccaagggggctattgacacctttgttcgctgcatggccatcgactgcggagacaagaag
atcaccgtgaatgcggtggcccctggagtcatcaagactgatatgtttttggctgtgtcg
cgggagtatatccccaatggtgagactttcaccgatgagcaggtagacgagtgtgccgct
tggctctctcctttgaaccgcgtgggcctccctgtggatgtcgcccgggtagtgagcttc
ctggcatctgacgcagccgaatgggtaagtggaaagatcattggggtggatggtggcgct
tttcgataa

DBGET integrated database retrieval system