KEGG   Amycolatopsis orientalis: SD37_05095
Entry
SD37_05095        CDS       T06703                                 
Name
(GenBank) 2,3-dihydroxybenzoate-AMP ligase
  KO
K20423  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase [EC:6.2.1.43]
Organism
aori  Amycolatopsis orientalis
Pathway
aori01059  Biosynthesis of enediyne antibiotics
aori01100  Metabolic pathways
aori01110  Biosynthesis of secondary metabolites
Module
aori_M00830  Neocarzinostatin naphthoate moiety biosynthesis, malonyl-CoA => 2-hydroxy-5-methyl-1-naphthoate => 2-hydroxy-7-methoxy-5-methyl-1-naphthoyl-CoA
Brite
KEGG Orthology (KO) [BR:aori00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    SD37_05095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:aori01008]
    SD37_05095
Enzymes [BR:aori01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.43  2-hydroxy-7-methoxy-5-methyl-1-naphthoate---CoA ligase
     SD37_05095
Polyketide biosynthesis proteins [BR:aori01008]
 Polyketide tailoring proteins
  Others
   SD37_05095
SSDB
Motif
Pfam: AMP-binding AMP-binding_C GH3
Other DBs
NCBI-ProteinID: ANN15097
UniProt: A0A193BSB7
LinkDB
Position
complement(1036896..1038569)
AA seq 557 aa
MPGSAGRSTGTGVVPWPRSVADRYFAEGYWEGRSLGTQLAETARKYPDEVCLVDGEVRLT
FGELLAKADGAAIRMSAAGIGADDRVVIQLPNCWEFVVTTVACLRLGAVPVWTMPQFREH
EIGGILANAEAGAIVVPDVHKGFDHQALAREVLPDGLVFVVGEDVHPGNIDLRALFVADE
PAEVSQALDAAAPNGDAVATFLLSGGTTGLPKLIPRSGNDLSYMIKTASEICRFGPDTSY
LVVLPLGHGFANTGPGILGALLSGGRVVIAPSPAPHQALPLIESERITATSAVPAILHRW
IEYLDSAPGFDLSTLEMIQIGAAKLDPSLAAQVRPKLGCTLQQVFGMGEGLLCLTRLDDP
DELILHTQGKPISPGDELRLVDEEGVPVAPGEPGLLLVRGPYTTRGYYRSPELNARSFVD
GGWYNTGDIVRLTPEGYLVVSGREKDVINRGGEKINAEEIETFALEVSGVEHAAAVAMPD
AELGEVVCLYVVATRPVALQDVHTLMLAAGAARFKLPERLVVVDALPATGIGKVDKKALR
ADIASRLTEELKGTIAA
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgccgggatcagcgggacggtcgaccgggacgggagtcgtgccgtggccgagaagcgtc
gcggaccgctatttcgccgagggctattgggaaggccggtcgctggggacgcagctggcc
gaaaccgcgcgcaagtacccggacgaggtctgcctcgtcgacggggaggtgcgactgacg
ttcggtgagctgctggcgaaggccgacggagcggcgatccggatgagcgcggccgggatc
ggcgccgatgaccgggtcgtcatccagttgccgaactgctgggagttcgtcgtcaccacg
gtcgcctgtctccggctcggcgccgttccggtgtggacgatgccgcagttccgcgagcac
gagatcggcggcatcctcgccaacgccgaagcgggcgcgatcgtcgtcccggatgtccac
aaaggattcgaccatcaggcgctggcccgtgaagtcctgccggacgggctcgtgttcgtg
gtcggcgaggacgtccaccctggcaacatcgacctccgggcgttgttcgtcgcggacgaa
cccgccgaagtctcgcaagccctcgacgcggccgccccgaacggggacgccgtcgcgacc
ttcctgctctccggcgggacgaccgggctgccgaagctgatcccgcgcagtggcaacgac
ttgagctacatgatcaagaccgcctcggagatctgccggttcggcccggacacctcgtac
ctggtggtgctgccgctcggacacggattcgccaataccggtccgggtatcctgggcgcg
ctgctgtccggcggccgggtcgtcatcgcgccgtccccggcgccgcaccaggcgctgccg
ttgatcgaaagcgagcggatcaccgcgacttccgcggtgccggcgatcttgcatcgctgg
atcgaatacctggactccgcccccggattcgatctgtccactttggaaatgatccagatc
ggcgcggccaagctcgatccctcgctggcggcgcaggtgcggccgaagctcggctgcacg
ctgcagcaggtcttcgggatgggtgaaggactcctgtgcctgacccggctcgacgatccg
gacgagctgatcctgcacacccagggcaaaccgatctcgcccggggacgaactccggctc
gtggacgaagaaggcgtcccggtggcgcctggtgagcccgggttgctgctggtccgcggc
ccgtacacgactcgcggttactaccgctcccccgagctgaacgcgcgctcgttcgtcgac
ggcggctggtacaacaccggcgacatcgtccggctgacgcccgagggctatctggtggtc
tccgggcgcgagaaggacgtcatcaaccgcggcggggagaagatcaacgccgaggagatc
gagaccttcgcgctggaggtatccggtgtcgagcacgcggccgcggtcgcgatgccggac
gcggaactcggcgaggtcgtctgcctctatgtggtcgccacccggccggtggccctgcag
gacgtgcacaccctgatgctcgccgcgggcgccgcgcggttcaagctgccggagcggctg
gtcgtcgtcgacgccttgcccgccacgggaatcgggaaggtcgacaagaaggcgctgcgg
gccgacatcgcgtcacgcctgactgaggagctgaagggaaccatcgccgcatag

DBGET integrated database retrieval system