KEGG   Amycolatopsis orientalis: SD37_34210
Entry
SD37_34210        CDS       T06703                                 
Name
(GenBank) hypothetical protein
  KO
K14256  anhydrotetracycline 6-monooxygenase / 5a,11a-dehydrotetracycline 5-monooxygenase [EC:1.14.13.38 1.14.13.234]
Organism
aori  Amycolatopsis orientalis
Pathway
aori00253  Tetracycline biosynthesis
aori01057  Biosynthesis of type II polyketide products
aori01100  Metabolic pathways
aori01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aori00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    SD37_34210
   00253 Tetracycline biosynthesis
    SD37_34210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:aori01008]
    SD37_34210
Enzymes [BR:aori01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.38  anhydrotetracycline 6-monooxygenase
     SD37_34210
    1.14.13.234  5a,11a-dehydrotetracycline 5-monooxygenase
     SD37_34210
Polyketide biosynthesis proteins [BR:aori01008]
 Polyketide tailoring proteins
  Oxygenase
   SD37_34210
SSDB
Motif
Pfam: FAD_binding_3 Pyr_redox Pyr_redox_2 DAO FAD_binding_2 HI0933_like NAD_binding_8 Pyr_redox_3 Lycopene_cycl
Other DBs
NCBI-ProteinID: ANN20156
UniProt: A0A193C6D8
LinkDB
Position
7900682..7902142
AA seq 486 aa
MDYDVLVVGGGPTGMMLAAELRLAGVRPLVVERLARPYPFSKALGIHARSIELLELRGIH
DRFLEGAPLLSGGHFASLPVGLNYKSLETRHPYGLYQKQVDTERLLTARAEELGTEIRRG
HELTALAQDEDGVTATITGPDGEYRVRAGYVVGCDGGRSRTRKLAGIPFPGQEPGLAVLM
ADCEFSGELPEGEGMGPLRPYGVIRRDLRAWFSAVPLFEPGVYRAMVFRYDHVWPDRDQP
VTEEEMRAAITELVGHDCGLTGIQWLTRLTDVSRQAERYREGRVLLAGDAAHVHFPSGGP
GLNMGLQDAMNLGWKLAAVVNGWGDGALLDSYHTERHPVGRTVLRNTRTQCALFDPDPRL
DAVRETFTDLLRIDQVNRYFTGLGSALDVRYDLPGEHPLTGARMPDLDVWTPDGVRRLSE
YFHDGLGVLTGASAEKWKDRVAVVEGEVEGPAMLVRPDGYVCWAGDPVEDGVGLDAALRT
WFGPPL
NT seq 1461 nt   +upstreamnt  +downstreamnt
gtggactacgacgtcctggtggtcggcggcgggccgaccggaatgatgctcgccgccgaa
ctgcggctggccggggtccgcccgctggtcgtcgaacgactggcacggccctacccgttc
tcgaaggcgctgggcatccacgcccgcagcatcgaactcctcgaactgcgcggcatccac
gaccggttcctggagggcgccccgctgctttcgggcgggcacttcgccagtctgccggtc
gggctgaactacaaatcgctggaaacccggcatccctatggcctgtaccagaaacaggtc
gacacggaacgcctcctcaccgcacgcgccgaggaactgggcaccgagatccggcgcggg
cacgaactcaccgcgctggcgcaggacgaggacggcgtcacggccaccatcaccggaccc
gacggggaataccgggtgcgggcgggctacgtcgtcggctgcgacggtggccgcagccgg
acccgcaaactggccgggatccctttccccggacaggaaccggggctggccgtactcatg
gccgactgcgagttctcgggcgagctgcccgagggcgaaggcatgggaccgttgcgcccg
tacggcgtcatccggcgcgatctgcgggcgtggttctcggcggtgccgctgttcgaaccc
ggcgtctaccgcgccatggtgttccgctacgaccacgtctggccggatcgcgatcagccg
gtgaccgaggaggagatgcgcgcggcgatcaccgaactcgtcggccacgactgcggcctg
accgggatccagtggctcacgcgcctgaccgacgtctcccgccaggccgagcggtaccgg
gagggccgggtcctgctcgcgggcgacgccgcccacgtgcatttcccgtcgggcgggccg
gggctcaacatgggcctgcaggacgcgatgaacctcggctggaaactcgcggcggtggtg
aacggctggggcgacggcgcgctgctcgacagctaccacaccgagcggcatccggtgggg
cgcacggtgttgcgcaacacccggacccagtgcgcgctgttcgatcccgatccccggctg
gacgccgtccgggagaccttcaccgatctgctgcgcatcgaccaggtcaaccgctacttc
accggcctcggctcggcactcgacgtgcggtacgacctgcccggcgagcatcccctcacc
ggggcgcgtatgcccgatctggacgtgtggaccccggacggcgtccggcggctcagcgag
tacttccacgacggcctcggcgtgctgaccggggcctccgcggagaaatggaaggaccgg
gtggcggtcgtcgaaggagaggtcgaggggccggcgatgctcgtccggccggacggatac
gtctgctgggcaggcgatcccgtcgaggacggagtgggcctcgacgcggctctccggacc
tggttcggaccgccgttgtaa

DBGET integrated database retrieval system