Isoalcanivorax pacificus: S7S_14830 Help Entry S7S_14830         CDS       T03580                                  Name (GenBank) anti-sigma-28 factor   KO K02398   negative regulator of flagellin synthesis FlgM Organism apac  Isoalcanivorax pacificus Pathway apac02020   Two-component system apac02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:apac00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     S7S_14830  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     S7S_14830  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:apac02035]     S7S_14830 Bacterial motility proteins [BR:apac02035]  Flagellar system   Flagellar assembly proteins    Others     S7S_14830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM DUF6285 Motif Other DBs NCBI-ProteinID:  AJD49378 UniProt:  A0A0B4XSH9 LinkDB All DBs Position 3328110..3328382 Genome browser AA seq 90 aa AA seqDB search MKIDKLTPLTSPGSLAPGKQTDRSAGAGDASAGSSAAVTHLRHQGSSDQDINTARVEEIR QAISEGRLEIRTDQIADALIASVRDLLGRS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ttgaaaatcgacaagctcactccgttgacgtcgccgggcagcctggcgccgggcaagcag actgaccgcagcgccggcgcgggcgatgcctccgccggcagcagcgcggcggtcactcac ctgcgccatcagggcagcagtgatcaggacatcaataccgcccgggtggaggaaatccgc caggccatcagcgaggggcggctggaaatccgcaccgaccagatcgccgacgcgctgatc gccagcgtgcgcgacctgctgggccgttcatga

DBGET integrated database retrieval system