KEGG   Arcanobacterium phocisimile: JTE88_08705
Entry
JTE88_08705       CDS       T07205                                 

Name
(GenBank) aminoglycoside phosphotransferase family protein
  KO
K13059  N-acetylhexosamine 1-kinase [EC:2.7.1.162]
Organism
apho  Arcanobacterium phocisimile
Brite
KEGG Orthology (KO) [BR:apho00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JTE88_08705
Enzymes [BR:apho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.162  N-acetylhexosamine 1-kinase
     JTE88_08705
SSDB
Motif
Pfam: APH Choline_kinase
Other DBs
NCBI-ProteinID: QRV02133
LinkDB
Position
complement(1919118..1920191)
AA seq 357 aa
MNEAWSIAQKFCIRGEHVSSTRWGDGHINRTYRVTTSSDDYIVQQINKTVFADVDSLMNN
IKLVTEHLGKKGKETLEIIPTLDNKLYLRQGEEYFRMYRYIGNSRSYSLATSPNMVRSVA
AAFGQFQRDLADFDATLLAETIPFFHHTPTRYHNLLAAVEKNTSGRVAEVTDEIEFFTQR
AAEYSYVTDLLTTGEIPSRVTHNDTKINNILLDADTGEVRAVIDLDTVMPGSLLYDFGDA
LRTGAALADEDEKDRSKVGFSLDLYTAYCEGFIPTLRETLTPAERDLLAFSAKLMTAECG
MRFLTDYIDGDVYFATAYAEHNLVRARNQIALVADIERKYDQMCEIANRAYNGQEEK
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgaatgaagcatggagcattgcacaaaaattctgtattcgcggggaacacgtctcgagt
actcgttggggtgacgggcatattaaccgaacctatcgagtgacaaccagtagcgacgac
tacatcgtgcagcagatcaacaaaaccgtgtttgcggatgtggatagtttgatgaacaac
atcaagctcgtcaccgaacatttagggaagaaaggcaaagagacgctggagattattccg
acgctcgataacaagctgtatcttcgccaaggggaagaatatttccgcatgtatcgctat
atcggcaactcgcgctcatacagtttggcaacttcgccaaacatggtgcgctcagtggct
gcagcattcggtcaattccagcgtgacttggcagatttcgatgccacgttgttggcagaa
acgataccgttcttccaccacaccccgacgcgctatcacaacctgttagcggcggttgag
aagaatacttccggacgagtggcagaagttactgacgagatcgagttcttcacccagcga
gcagctgaatattcctacgtgactgacctgctgacaaccggggagattccctcgcgcgta
acccacaacgacaccaagatcaacaacatcttgcttgatgcagataccggagaagtccgg
gccgtgatcgatcttgacaccgtcatgcccggttccttactctacgacttcggcgatgcg
ttacgtaccggcgctgcccttgccgatgaagacgaaaaagatcgttcgaaagtaggtttc
agcctcgatctttacaccgcatactgcgaaggcttcatccccacattgcgtgaaaccctc
acaccagccgaacgagatctgctagcattttcagcgaaactcatgaccgccgaatgcggt
atgcggttcttaacagactatatcgacggagatgtttactttgcgaccgcatatgccgaa
cacaatctggtacgtgcccgtaaccagatcgcgctcgttgctgacatcgaacgcaaatat
gaccagatgtgcgagatagccaaccgagcctataacggacaagaggagaagtaa

DBGET integrated database retrieval system