KEGG   Anas platyrhynchos (mallard): 101789456
Entry
101789456         CDS       T02816                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein isoform X2
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
apla  Anas platyrhynchos (mallard)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 101789456
NCBI-ProteinID: XP_005013896
LinkDB
Position
1:complement(94730028..94745611)
AA seq 106 aa
MANRTNSSEYFWSYEYYWDYIDPIPVDGRKLKVNKYSIVIAFWVGLAAFVMFLFLILLYM
SRSGSSPVKRVIVGNQAEESSSNSEQPHCDDLSSPYTDEVAPGTPN
NT seq 321 nt   +upstreamnt  +downstreamnt
atggccaacaggaccaactcgtcggagtacttttggtcctatgagtattactgggattac
attgacccgatcccagtggatggaaggaagctgaaggttaataaatattctattgtcata
gccttttgggttggacttgctgcctttgtgatgtttcttttccttattttgctgtatatg
tcccgctctggatcaagtccagtaaaacgggtgattgtagggaaccaggcagaagaaagc
agttccaacagcgaacagcctcactgcgatgacctcagcagcccatacacggatgaggtt
gctcctggaacacctaactaa

DBGET integrated database retrieval system