Anas platyrhynchos (mallard): 101793649 Help Entry 101793649         CDS       T02816                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism apla  Anas platyrhynchos (mallard) Pathway apla04010   MAPK signaling pathway apla04012   ErbB signaling pathway apla04068   FoxO signaling pathway apla04137   Mitophagy - animal apla04140   Autophagy - animal apla04144   Endocytosis apla04150   mTOR signaling pathway apla04210   Apoptosis apla04218   Cellular senescence apla04370   VEGF signaling pathway apla04371   Apelin signaling pathway apla04510   Focal adhesion apla04540   Gap junction apla04625   C-type lectin receptor signaling pathway apla04810   Regulation of actin cytoskeleton apla04910   Insulin signaling pathway apla04912   GnRH signaling pathway apla04916   Melanogenesis apla05132   Salmonella infection Brite KEGG Orthology (KO) [BR:apla00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101793649 (HRAS)    04012 ErbB signaling pathway     101793649 (HRAS)    04370 VEGF signaling pathway     101793649 (HRAS)    04371 Apelin signaling pathway     101793649 (HRAS)    04068 FoxO signaling pathway     101793649 (HRAS)    04150 mTOR signaling pathway     101793649 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101793649 (HRAS)    04140 Autophagy - animal     101793649 (HRAS)    04137 Mitophagy - animal     101793649 (HRAS)   09143 Cell growth and death    04210 Apoptosis     101793649 (HRAS)    04218 Cellular senescence     101793649 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101793649 (HRAS)    04540 Gap junction     101793649 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101793649 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101793649 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     101793649 (HRAS)    04912 GnRH signaling pathway     101793649 (HRAS)    04916 Melanogenesis     101793649 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101793649 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apla04131]     101793649 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:apla04147]     101793649 (HRAS)    04031 GTP-binding proteins [BR:apla04031]     101793649 (HRAS) Membrane trafficking [BR:apla04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     101793649 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     101793649 (HRAS) Exosome [BR:apla04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    101793649 (HRAS)   Exosomal proteins of colorectal cancer cells    101793649 (HRAS) GTP-binding proteins [BR:apla04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101793649 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  101793649 NCBI-ProteinID:  XP_038035313 Ensembl:  ENSAPLG00000012248 LinkDB All DBs Position 5:complement(46588746..46623419) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggagctggtggcgtggggaagagcgcgctgacg atacagctcatccagaaccatttcgtcgatgagtatgaccccacgatagaggattcctac agaaagcaagtggtcattgatggagagacctgtctgctggacatcttggacacagcgggg caggaggagtacagcgccatgcgagaccagtacatgaggacgggggagggattcctctgc gtcttcgccattaacaacaccaagtccttcgaggatatccaccagtacagggagcagatc aagagggtgaaggactcagatgatgtccccatggtgctggtggggaacaaatgtgacctg ccagcccggacagtggagacgcggcaagcacaggacctggcccggagttacgggatcccc tacatagaaacgtcggccaaaaccagacagggcgtcgaggatgccttctacaccttagtg cgggagatccggcagcacaaactgcgcaagctgaatccgcccgacgagagcggccctggc tgcatgaactgtaaatgtgtcgtctcgtga

DBGET integrated database retrieval system