Actinobacillus porcitonsillarum: DDU33_01095 Help Entry DDU33_01095       CDS       T05443                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism apor  Actinobacillus porcitonsillarum Pathway apor02024   Quorum sensing apor03018   RNA degradation Brite KEGG Orthology (KO) [BR:apor00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     DDU33_01095  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     DDU33_01095  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:apor03019]     DDU33_01095    03036 Chromosome and associated proteins [BR:apor03036]     DDU33_01095 Messenger RNA biogenesis [BR:apor03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      DDU33_01095 Chromosome and associated proteins [BR:apor03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     DDU33_01095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Gag_p24_C Motif Other DBs NCBI-ProteinID:  AWI50180 UniProt:  A0A2U8FGS1 LinkDB All DBs Position complement(212921..213205) Genome browser AA seq 94 aa AA seqDB search MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPARAISHSNHNGNGHQQAAQQSDVVAEKVAE NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaggtcaatctttacaagacccatatttaaatgcactccgccgtgagcgtatt cctgtttcgatctatttagtaaatgggattaaattacaaggtcaaatcgagtcattcgac caatttgtgattttattaaaaaacacagtgagtcagatggtttataaacatgcaatttca acggttgtgcctgcacgtgcgatttctcattctaaccataatggtaatggacatcagcaa gcagctcaacaatcagatgttgttgcagaaaaagtagcggaataa

DBGET integrated database retrieval system