KEGG   Agrobacterium radiobacter: Arad_14154
Entry
Arad_14154        CDS       T00850                                 
Symbol
noxA
Name
(GenBank) conserved hypothetical protein
  KO
K24952  nopaline oxidase subunit A
Organism
ara  Agrobacterium radiobacter
Pathway
ara00330  Arginine and proline metabolism
ara01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Arad_14154 (noxA)
SSDB
Motif
Pfam: Pyr_redox_2 Fer2_BFD NAD_binding_8 FAD_oxidored DAO SO_alpha_A3 FAD_binding_2 HI0933_like Thi4 Lycopene_cycl NAD_binding_9 FAD_binding_3 AlaDh_PNT_C Pyr_redox_3 GIDA
Other DBs
NCBI-ProteinID: ACM31018
UniProt: B9JPE9
LinkDB
Position
pAtK84b:complement(106040..107458)
AA seq 472 aa
MNPNSSADLLIVGAGPAGMAAARRAVRGGLSVVLLDSQSQPGGQIWRNAGSNATSPVINV
LGAEYRRGIRQIEAFLASGADYIPEAQVSRLSQGWTVEYVKGGEIRSVMGRHLLLAMGAQ
ERPVPFTGWTLPGIMTVGAAQILLKTAGQLPRGPVAVVGSGPLPLLYMQQMRLAGTKPVA
YLDTTPRGLISRSLRGFRGALKEPGQILKGIAWLPQFSGVRHVRNVVKISAEGSGRLETV
RFETSNGRSDRLEVKSLLVHEGLVPSHQLAVSVGAQLMWDVGQSAFRLERDEWMNAGPDG
LYIAGDGARIGGAVNAEIEGEIAATGILLRDGALTAAQADAETKPLRAHHAGQKAFRRFL
DGVYPPNIARTQPDDATIVCRCEELSAGVLREAAVRGACRGPNQLKSFTRAGMGPCQGRQ
CGYPVHELVKSVAGLTAGEVGLFNPRPPFVPLTVSMLAAQQAEEVVSASTHE
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgaacccgaattcgagcgccgacctgttaatcgtcggagctggccccgctggcatggcc
gccgcgaggcgagctgtgcgcggcggcctatccgtcgtcttgctggattcgcaatcacag
cccggaggtcagatctggcgtaatgccggcagcaacgcgacgagcccggtcataaacgtt
ctgggggcggaatatcgacgcggcatccggcaaatcgaagcattcctggccagcggcgcc
gactacattccggaggctcaggtaagcaggctcagccagggttggacggtggaatatgta
aagggtggagaaattcgttctgtcatgggacggcatctcttgctcgctatgggcgcacag
gaacgcccggttccgttcaccggctggacgctacccggcatcatgacggtcggcgccgca
cagattctccttaagacggcgggccaactgccacgggggccagttgccgtggtcgggagc
ggacctcttcccctactatacatgcagcagatgcggctcgccgggacaaagcccgtcgct
tatctcgatacgacccctcggggtctcatcagccgttcgctgcgcggttttcgcggggcg
ctaaaggagcccggccaaatcctgaaagggattgcctggttaccgcagttcagtggcgtt
cggcacgtacgcaacgtggtcaaaatcagcgccgaaggaagcggacgactggaaactgta
cggttcgaaacttcaaacggcaggtccgaccgattggaggtcaaatcccttcttgtacac
gaggggctggtgccaagccatcagttggccgtgtcggtcggcgcgcaactgatgtgggat
gtcggccagtcagcgttccggcttgagcgcgacgagtggatgaacgcaggtccggacgga
ctgtacatagccggggacggtgctcggatcggcggcgccgtcaatgccgagatcgaagga
gagatcgccgcgaccggtatccttcttcgtgacggcgccctgacggccgctcaggcggat
gccgagacaaaaccgctaagggcacatcatgccgggcaaaaggcgttccggcgatttctg
gatggagtctatccgccgaatattgcgcggacccagccggacgacgcaacgatcgtctgc
cggtgcgaagagttgagcgcgggcgtgttgagggaagctgctgtccgtggcgcttgccga
ggccctaaccagctgaagagctttacacgcgcgggcatgggtccctgtcagggaaggcag
tgcggctacccggtgcacgaactggtgaagtccgtcgccggtctgaccgctggcgaggtc
ggcctattcaatccgcggcctcccttcgttcccttaacggtatcgatgcttgcagctcag
caggccgaggaagtcgtttcagcgtcgacacatgagtga

DBGET integrated database retrieval system