KEGG   Acidovorax radicis: KI609_01680
Entry
KI609_01680       CDS       T08078                                 
Name
(GenBank) dienelactone hydrolase family protein
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
arad  Acidovorax radicis
Pathway
arad00361  Chlorocyclohexane and chlorobenzene degradation
arad00364  Fluorobenzoate degradation
arad00623  Toluene degradation
arad01100  Metabolic pathways
arad01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arad00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    KI609_01680
   00361 Chlorocyclohexane and chlorobenzene degradation
    KI609_01680
   00623 Toluene degradation
    KI609_01680
Enzymes [BR:arad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     KI609_01680
SSDB
Motif
Pfam: DLH BAAT_C FSH1 Peptidase_S15 Abhydrolase_2 Abhydrolase_11 ScdA_N
Other DBs
NCBI-ProteinID: UCU99553
LinkDB
Position
384467..385156
AA seq 229 aa
MGQFVDLASSDGFVVPAWVAQPEGTPRGAVVVVQEIFGVNSHIRSVADRLAARGYLAVAP
ATFQRVKPGVELGYTAEDMQAGMALKTAVDTLPAPGVMPDIQAAIDYAAQQSGRKVGIVG
FCWGGLLTWRAACQLKGLSAAVPYYGGGVTTPDEVARQPQVPVLAHFGERDHWIPLDSVQ
AFAKVHPEVDVHVYAADHGFNCDQRGSYDEAAATVAWDRTLAFFDRHLA
NT seq 690 nt   +upstreamnt  +downstreamnt
atgggacagtttgtcgatctggcgtcaagtgatggttttgtggtgcctgcctgggtggcc
cagcccgagggcacgccccggggcgccgtggtggtggtgcaggagatttttggcgtgaac
tcgcacatccgctcggtggccgaccgcttggccgcgcgggggtatctggccgtggcgccc
gccacgttccagcgcgtcaagccaggggtggagctgggctacaccgctgaggacatgcag
gcggggatggcgctcaagaccgcagtggacaccctgcccgcaccgggcgtgatgcccgac
atccaggccgccatcgattacgccgcccagcaaagcggtcgcaaggtgggcatcgtgggc
ttttgctggggcggcctgctgacctggcgcgcggcctgccagctcaagggcttgtcggca
gccgtgccctactacggcggcggtgtgaccacccccgacgaggtggcccgccaaccccag
gtgccggtgctggcccactttggcgagcgcgaccactggatcccgctcgatagcgtgcag
gcgttcgccaaggtccatcccgaggtcgacgtgcatgtatacgcggccgaccatggcttc
aactgcgaccagcgcggcagctacgacgaagccgctgccacggtcgcatgggaccgcacg
ctggcgttctttgaccgccatctggcctga

KEGG   Acidovorax radicis: KI609_06625
Entry
KI609_06625       CDS       T08078                                 
Name
(GenBank) dienelactone hydrolase family protein
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
arad  Acidovorax radicis
Pathway
arad00361  Chlorocyclohexane and chlorobenzene degradation
arad00364  Fluorobenzoate degradation
arad00623  Toluene degradation
arad01100  Metabolic pathways
arad01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arad00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    KI609_06625
   00361 Chlorocyclohexane and chlorobenzene degradation
    KI609_06625
   00623 Toluene degradation
    KI609_06625
Enzymes [BR:arad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     KI609_06625
SSDB
Motif
Pfam: DLH Abhydrolase_1 Chlorophyllase Peptidase_S15
Other DBs
NCBI-ProteinID: UCV00440
LinkDB
Position
1453000..1453896
AA seq 298 aa
MLNDNLHSDALALLPGRSTESGATRRTALQAALGLGYAVAAAPIMAQTAIATPTDGLTAG
PVSFVVDGFKVPAYRAAPAGKTGLPVVLVIQEIFGVHEYIADVCRRFAKAGYLAIAPDLY
ARQGDASGYTDIAKLMAEVVAKVPDAQVMADLDGAVQWATAHGGDAARVSVTGFCWGGRI
TWLYAAHGPVKAGVAWYGRLVGQYSELTPKHPIDIAPILKAPVLGLYGEKDAGIPLDTID
KMKIALSGGSPQAKASQFVVYPDAPHAFHADYRASYRKEAAEDGYQRALAWFKGHGVV
NT seq 897 nt   +upstreamnt  +downstreamnt
atgctcaatgacaacctccactctgacgccctggcgctgctgccgggccggtccacagaa
tcgggcgccacgcggcgcactgcgttgcaggccgcgctgggcctgggttatgcggtggcg
gctgcgcccatcatggcgcagacggccattgccacgccgaccgatgggttgacggcgggc
ccggtcagttttgtggtggatggcttcaaagtgcccgcctaccgtgcggcccctgcgggc
aaaacaggcctgcccgtggtgctggtcattcaggaaatcttcggcgtgcacgaatacatc
gctgatgtctgccgtcgtttcgccaaggcggggtatctggccattgcgcccgatctgtat
gcgcggcagggcgatgccagcggctataccgatatcgccaaactcatggccgaggtggtg
gccaaggtgcccgatgcccaggtgatggccgacctggacggcgcggtgcagtgggctacc
gcccatggcggcgatgccgcacgggtgagtgtcaccggtttttgttggggagggcgcatc
acctggctgtacgccgcccatggccccgtgaaagcgggggtggcgtggtacggccgcctg
gtagggcaatacagcgaactcacgcccaagcaccccattgatatcgctcccatcctcaaa
gccccggtgctcggcctttatggcgaaaaagatgcgggcataccccttgacacgattgat
aagatgaaaattgccttgtccggcggctcgccgcaagccaaggcatcgcagtttgtggtg
taccccgacgcgccccacgcgttccatgccgactaccgcgccagctaccgtaaggaagcg
gccgaagacggctaccagcgcgcgctggcgtggttcaaggggcacggggtggtgtga

DBGET integrated database retrieval system