KEGG   Acidovorax radicis: KI609_14820
Entry
KI609_14820       CDS       T08078                                 
Name
(GenBank) catechol 1,2-dioxygenase
  KO
K03381  catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
arad  Acidovorax radicis
Pathway
arad00361  Chlorocyclohexane and chlorobenzene degradation
arad00362  Benzoate degradation
arad00364  Fluorobenzoate degradation
arad00623  Toluene degradation
arad01100  Metabolic pathways
arad01120  Microbial metabolism in diverse environments
arad01220  Degradation of aromatic compounds
Module
arad_M00568  Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:arad00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KI609_14820
   00364 Fluorobenzoate degradation
    KI609_14820
   00361 Chlorocyclohexane and chlorobenzene degradation
    KI609_14820
   00623 Toluene degradation
    KI609_14820
Enzymes [BR:arad01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.1  catechol 1,2-dioxygenase
     KI609_14820
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg DUF4198
Other DBs
NCBI-ProteinID: UCU97828
LinkDB
Position
3253863..3254777
AA seq 304 aa
MAELTQAQLLELVNTKRIAPGNARVRQLTERIVTDLFKTINELDVTPDEFWAGIAWLTRL
GAAGQTGLITAGLGFDRLLDIRADEADQRAGRAGGTPRAIEGPLFVAGAPTSKAEARVDE
GEPKGEIFVMEGQVLDLDGTPVPHAMVDVWHANEQGGYSHFFPGMQPYELRRRIETDANG
FYRLRSFLPPGYAIPPTGPVADLFAALGRHGNRPAHIHFLVAAPGLRTLTTQVNIPGDTY
IDDDFAFATRDGLIVNLEKNVAPAGYESLGITAPFTRSRFNFVMQKAQDENEALPLTRME
RVAG
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcagaactcacccaggcccagttgctcgaactggtcaacaccaaaaggatcgccccc
ggcaatgcccgtgtgcgccagctcaccgagcgcatcgtcaccgacctgttcaagaccatc
aacgagctcgatgtgacccccgacgaattctgggcgggcatcgcctggctcacccgcctg
ggcgcggccggccagaccggcctgatcacggccgggctgggttttgaccgcctgctggac
atccgcgccgatgaggccgaccagcgcgccggccgtgccggtggcacaccccgagccatc
gaaggaccgctgttcgtagctggcgccccaacatccaaggcggaggcgcgtgtggacgag
ggcgagcccaagggcgagatcttcgtcatggaaggccaggtgctggacctcgacggcacg
cccgttccccatgccatggtcgatgtgtggcatgccaacgagcaaggcggctattcgcac
ttcttcccgggcatgcagccctacgaactgcgccgccgcatcgagaccgacgccaacggc
ttttaccgcttgcgcagcttcctgcccccgggctatgccattccacccaccggcccggtg
gccgatctgtttgcagccctcggccgccacggcaaccgccccgcgcacatccacttcctg
gtggctgcgccgggcctgcgcacactgaccacacaagtcaacatcccaggcgacacctac
atcgacgacgactttgccttcgccacgcgcgacggcctgatcgtgaacctggagaagaac
gtggcgcccgcaggctacgagtcgctgggcatcaccgcaccgttcacgcgttcgcgcttc
aacttcgtgatgcaaaaggcccaggacgaaaatgaagcgctgccgctgacccgcatggag
cgcgtggcgggctga

DBGET integrated database retrieval system