Arthrobacter sp. FB24: Arth_1280 Help Entry Arth_1280         CDS       T00421                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism art  Arthrobacter sp. FB24 Pathway art00074   Mycolic acid biosynthesis art00280   Valine, leucine and isoleucine degradation art00630   Glyoxylate and dicarboxylate metabolism art00640   Propanoate metabolism art01100   Metabolic pathways art01110   Biosynthesis of secondary metabolites art01120   Microbial metabolism in diverse environments art01200   Carbon metabolism Brite KEGG Orthology (KO) [BR:art00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     Arth_1280    00640 Propanoate metabolism     Arth_1280   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     Arth_1280   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     Arth_1280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  ABK02674 LinkDB All DBs Position complement(1420412..1420675) Genome browser AA seq 87 aa AA seqDB search MEPAAKAAVEPAQTPDGSGAEAAEPLFSVVKGKPTDVELVALTAVVLSLGSAEPEGEAKP SVRHWVRRQQLRLAPAPGPGAWKRSRG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtggagccggccgcaaaggcggcggttgaacccgcgcagactccggacggaagcggcgcc gaggccgcggagccgctgttctccgtggtcaagggcaaaccgaccgacgtcgaactcgtg gcgttgaccgccgtcgtgctctccctcggcagtgccgagccggaaggcgaggccaagccc agtgtccgccactgggtgcgccggcagcagctgcgcctggcccccgcccccgggccggga gcctggaagcgcagccgcggctga

DBGET integrated database retrieval system