KEGG   Arachnia rubra: J5A65_13335
Entry
J5A65_13335       CDS       T07339                                 
Name
(GenBank) thioesterase
  KO
K21791  thioesterase
Organism
arub  Arachnia rubra
Pathway
arub00333  Prodigiosin biosynthesis
arub01100  Metabolic pathways
arub01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arub00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    J5A65_13335
SSDB
Motif
Pfam: Thioesterase Abhydrolase_6 Hydrolase_4 Abhydrolase_1 Lipase_3
Other DBs
NCBI-ProteinID: QUC07878
LinkDB
Position
complement(2947624..2948415)
AA seq 263 aa
MVVVSLTVRKSSPGSLLNADKTCDHRPLFVLFHHAGGASSVFYSWVERLEAHGEVVALDL
PGRRRRLHDPVIRDITSAIVDVTETLRAALGTRPGRPFMMLGHSMGALLAYEAALDLRSK
GFREPEALFVSGSRVPSEYGESTRLLGIGGDADIAAEALGGSSELMALGARLPSPERIAL
LQADLEICRSRRQRGEAPLSCPVIALTGRGDSVATSEQIKRWARYTTGPFSRREYSGSHF
FLFDDAVASEVVDELICWADQIY
NT seq 792 nt   +upstreamnt  +downstreamnt
gtggtggtggtctcattgacagtgcggaaatcgtcgccgggatccctactcaacgccgac
aagacatgtgaccaccgtccgctcttcgtcctcttccaccatgctggaggcgcgagttcc
gtcttctactcatgggttgagcgtcttgaggctcacggtgaggttgtggccctcgatcta
cccggacggcgacggcgtctgcacgaccccgtgatccgggatatcacttcagccattgtg
gatgtcaccgaaactctgcgggcagcccttggaacaagacccggaaggccattcatgatg
ttggggcacagcatgggggcgcttctggcctatgaggctgctctcgacctcagaagcaag
ggcttccgggagcctgaggccctctttgtttcaggcagccgtgttccctcggaatacggt
gagtcgactcgcctgttgggcattggtggtgacgctgacatcgcggccgaggccttggga
ggaagctccgaactcatggcccttggagctcggctcccgagcccagagcgtatcgccctg
cttcaagccgatcttgagatctgtcgcagtcgacgacagcggggtgaggcgccgctttcc
tgtccagtcatcgcgttgacggggcgtggggattccgttgcgacgagtgagcagatcaaa
cgatgggccaggtacacgacgggtccattctcgcgacgtgagtattcaggctcgcacttc
tttctgttcgacgacgccgtcgcttcagaggtcgttgacgagctcatctgttgggccgac
cagatctattag

DBGET integrated database retrieval system