Alligator sinensis (Chinese alligator): 102372206 Help Entry 102372206         CDS       T02922                                  Name (RefSeq) C-C motif chemokine 4-like   KO K05408   C-C motif chemokine 3 Organism asn  Alligator sinensis (Chinese alligator) Pathway asn04060   Cytokine-cytokine receptor interaction asn04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:asn00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102372206  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102372206  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:asn04052]     102372206    00536 Glycosaminoglycan binding proteins [BR:asn00536]     102372206 Cytokines and neuropeptides [BR:asn04052]  Cytokines   Chemokines    102372206 Glycosaminoglycan binding proteins [BR:asn00536]  Heparan sulfate / Heparin   Chemokines    102372206 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102372206 NCBI-ProteinID:  XP_006038480 UniProt:  A0A1U7SIK6 LinkDB All DBs Position Unknown AA seq 90 aa AA seqDB search MKAAVAALTVLLLASCCSYIQAQYGPNTPTLCCFSYASKKIPQVHLLSYKVPSSMCSQPA VIFTTKRGREICADPKAQWVQDYMKDLKQN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaggctgctgtggctgccctcactgtgctcctccttgcttcctgctgctcctacatc caggctcagtatggacctaacactccaaccctctgctgcttctcttatgcatccaagaag atcccacaggtccatttactttcctacaaggtccctagcagcatgtgctcccagccagca gtgatcttcaccactaagagaggccgggaaatctgtgctgatcccaaagcacaatgggtc caggactacatgaaagacctaaagcaaaactga

DBGET integrated database retrieval system