Alligator sinensis (Chinese alligator): 102378782 Help Entry 102378782         CDS       T02922                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism asn  Alligator sinensis (Chinese alligator) Pathway asn00510   N-Glycan biosynthesis asn00513   Various types of N-glycan biosynthesis asn04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:asn00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     102378782 (TMEM258)    00513 Various types of N-glycan biosynthesis     102378782 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102378782 (TMEM258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  102378782 NCBI-ProteinID:  XP_006026073 UniProt:  A0A1U7S878 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggcaatgagccgctacacgagcccggtgaacccggccgtgttcccgcac ctcaccgtggtgctgctggccatcggcatgttcttcaccgcctggttcttcgtctacgaa gtgacctccaccaagtacacacgggatatctacaaggagctactcatttccctggtggct tcgctattcatgggcttcggagtccttttcctgctgctctgggtcgggatctacgtgtga

DBGET integrated database retrieval system