KEGG   Aneurinibacillus soli: CB4_02728
Entry
CB4_02728         CDS       T05174                                 
Symbol
bioI
Name
(GenBank) Biotin biosynthesis cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
asoc  Aneurinibacillus soli
Pathway
asoc00780  Biotin metabolism
asoc01100  Metabolic pathways
asoc01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:asoc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CB4_02728 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:asoc00199]
    CB4_02728 (bioI)
Enzymes [BR:asoc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     CB4_02728 (bioI)
Cytochrome P450 [BR:asoc00199]
 Cytochrome P450, bacteria type
  CYP107 family
   CB4_02728 (bioI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: BAU28553
UniProt: A0A0U4WJ13
LinkDB
Position
complement(2664847..2666064)
AA seq 405 aa
MVENIVQASRFNPLSPEFRTNPYPFYDALRAAAPVHWMSSIDQEAWFVTSYKEAFSILKD
CRFEKRMRIPETSEAYGPLAHIQKNMMLFKNPPDHTRLRMLVSKAFTPHMIERLYPYIEE
TVNELLHKAQHTGKMELISEFAFPLPVIVITKMLGIPVDDRDQFREWANVLIRTIDLSRT
DESLEQGGEVARNLVGYFHSLIGQRRQHPQNDLMSQLIQAEEEGDRLNEDELVAMCILLL
VAGHETTMNLIGNGMLSLLQHPQQCEKLRENPALISTAIEEILRYESPTQMTVRFATEDV
EIGGKVIRKGQQVYIVLGAANRDPEVFSDPDQLDITRTPNHHLAFGTGIHFCLGAPLARL
EAEIAIRTLLQRVPTLKLDTNIPQWRGLIGFRSLHALPVSFEKTR
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggtagaaaatatcgtacaggcaagcaggttcaatccattatcaccagagtttcggaca
aatccatatccattttacgatgcacttcgggctgcagctccagtacactggatgtcctcg
attgatcaggaagcatggtttgtcacaagttataaagaggcgttctcgattctcaaagat
tgtcgctttgaaaagcggatgagaattcctgaaacttctgaggcgtatggacctcttgct
catatccaaaaaaatatgatgcttttcaaaaatccacccgatcacacgcggttgcggatg
ctcgtaagcaaagcattcacccctcatatgatcgaaaggctgtatccgtatatagaagaa
acagtgaatgagcttcttcataaggcacagcatacagggaaaatggagctcatctcggag
tttgcttttccactacctgtcattgtcattacgaaaatgctaggcataccggttgacgat
cgtgaccagttcagagaatgggcgaatgttttgattcgcaccattgatttaagcagaacg
gacgagtcgctcgagcaaggtggagaggttgccagaaatctcgtaggatacttccatagt
cttatcggacagcgtcgtcaacatccccagaatgatttaatgagtcagctcattcaggca
gaagaagaaggcgatcgattgaatgaagacgagctagtagccatgtgtatcttgttgttg
gttgctggacatgagactacgatgaatctgatcgggaatggaatgctttccttgttgcag
catcctcagcaatgtgaaaaattaagagaaaaccctgcgcttatttcaacagctattgag
gaaattttacgatatgagagcccgacacaaatgacggttcgctttgcaacagaagacgtt
gaaatcggtggaaaggtcattcgaaaagggcagcaagtttatatcgtgttaggagcagcg
aatcgagatccggaagtgttttccgacccggaccaactagatattactcgaacgccgaat
catcatcttgcatttggaacaggtattcatttctgtttaggtgctccgctggcacgtctg
gaagcggaaattgctattcgtacgttactgcagagggtgcctacactgaagctggacacg
aatataccacaatggagaggcttgattggttttagaagtctgcacgccttgcccgtttct
tttgaaaaaactcggtaa

DBGET integrated database retrieval system