KEGG   Aneurinibacillus soli: CB4_03376
Entry
CB4_03376         CDS       T05174                                 
Name
(GenBank) Purine-binding protein precursor
  KO
K05519  transcriptional activator of comK gene
Organism
asoc  Aneurinibacillus soli
Brite
KEGG Orthology (KO) [BR:asoc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:asoc03000]
    CB4_03376
Transcription factors [BR:asoc03000]
 Prokaryotic type
  Other transcription factors
   Others
    CB4_03376
SSDB
Motif
Pfam: Bmp PDDEXK_5
Other DBs
NCBI-ProteinID: BAU29195
UniProt: A0A0U4WL69
LinkDB
Position
complement(3301261..3302376)
AA seq 371 aa
MKNPESPDFFLQFLHFYPCKRNVYNMNRVIGKGMGVIMKKIVIMVLFLLLVGCVPHGQSA
MNQSVSQAIVPLKVGLLVDGKIYDQGWDGQAYRGLKAIERTYQAQVECIQDADQPDVQWR
EAKRLADSRYDLIFGNGRSFEAVFNKLAVSYPKTRFVFFNGKAQGENVSAINFTPESTGY
FSGMIAGTMTKSHKVGLIPAYQSMREVKPFIAAVKEQNPNNEVLVQDVKSWSDGKKAGEI
ARKMIKEGADVLAPMGDGFNIDVIMEAHHAGQLAVGYISDQYFVSKNTVITSVVQNLSSL
YVRIFEQYQSGALKSGDVEVDFADGAQQLGTFSPTVPDEVRRKINKKLEEYEHGAFVLDK
QTGQPVSNPEK
NT seq 1116 nt   +upstreamnt  +downstreamnt
gtgaaaaatccggagtctccggatttttttctgcaatttttgcacttctatccctgcaaa
cgaaatgtttacaatatgaacagagtgataggtaaagggatgggcgttataatgaaaaaa
atagtaatcatggtactgtttttgttacttgtgggatgtgttccacacgggcaatcggct
atgaatcaatctgtcagccaggctatagtcccgctcaaggtcgggctacttgtcgacgga
aagatttacgatcagggatgggatgggcaggcatatcgtggattgaaagcaattgaacga
acataccaggctcaggtcgaatgtattcaagacgctgatcaacccgacgttcagtggagg
gaagcgaagcggctggctgattcgaggtacgacttgatttttggcaatggccgaagcttt
gaggcagtgtttaataaactagctgtctcgtatccaaagacccgatttgtgttttttaat
ggaaaggctcagggagagaatgtatccgcaattaattttacaccggaatcaacgggatac
ttctctggcatgattgcaggcacgatgacgaaaagtcataaggtaggattgattccggcc
tatcaatccatgcgtgaggttaagccatttattgcagcagtcaaagagcaaaatccgaat
aatgaagtactggttcaggatgtgaaaagttggagcgacgggaaaaaagccggagaaatt
gctcgaaagatgattaaggaaggtgcagatgttctggctcctatgggggacggatttaac
attgatgtgattatggaagcgcaccatgcgggtcagctggcggttggctacatatcagat
cagtattttgtatccaaaaatacagtcattacaagcgtcgtacaaaatttatcgtcgctg
tatgtgagaatatttgagcagtatcagagcggcgcgttgaaaagcggagacgtggaagtc
gattttgcagatggggctcagcagttgggcacattcagtccaaccgtaccagatgaggtg
cgaaggaaaataaacaaaaagctggaagagtacgagcatggggcatttgtgctcgataaa
caaaccggacagccggttagcaatccggaaaaataa

DBGET integrated database retrieval system