Atlantibacter subterraneus: NLZ15_20010 Help Entry NLZ15_20010       CDS       T08300                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism asub  Atlantibacter subterraneus Pathway asub02024   Quorum sensing asub03018   RNA degradation Brite KEGG Orthology (KO) [BR:asub00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     NLZ15_20010 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     NLZ15_20010 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:asub03019]     NLZ15_20010 (hfq)    03036 Chromosome and associated proteins [BR:asub03036]     NLZ15_20010 (hfq) Messenger RNA biogenesis [BR:asub03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      NLZ15_20010 (hfq) Chromosome and associated proteins [BR:asub03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     NLZ15_20010 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  UTJ47078 LinkDB All DBs Position complement(4213592..4213900) Genome browser AA seq 102 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGSTGSNYHHSNAQGASAPQQDSDDAE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagatccgttcttgaacgcactgcgtcgcgaacgtgtt ccagtttctatttatttggtgaatggtattaagctgcaagggcagattgagtctttcgat cagttcgtgattttgttgaaaaacacggttagccagatggtgtataagcacgcaatctct acggttgtgccgtctcgcccggtttctcatcacagcaacaacgccggtggcagtacgggt agtaactaccaccacagtaatgcgcagggtgcatctgcaccacagcaagacagcgacgac gccgaataa

DBGET integrated database retrieval system