KEGG   Apodemus sylvaticus (European woodmouse): 127682882
Entry
127682882         CDS       T10613                                 
Symbol
Nras
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
asyl  Apodemus sylvaticus (European woodmouse)
Pathway
asyl01521  EGFR tyrosine kinase inhibitor resistance
asyl01522  Endocrine resistance
asyl04010  MAPK signaling pathway
asyl04012  ErbB signaling pathway
asyl04014  Ras signaling pathway
asyl04015  Rap1 signaling pathway
asyl04062  Chemokine signaling pathway
asyl04068  FoxO signaling pathway
asyl04071  Sphingolipid signaling pathway
asyl04072  Phospholipase D signaling pathway
asyl04137  Mitophagy - animal
asyl04140  Autophagy - animal
asyl04150  mTOR signaling pathway
asyl04151  PI3K-Akt signaling pathway
asyl04210  Apoptosis
asyl04211  Longevity regulating pathway
asyl04213  Longevity regulating pathway - multiple species
asyl04218  Cellular senescence
asyl04360  Axon guidance
asyl04370  VEGF signaling pathway
asyl04371  Apelin signaling pathway
asyl04540  Gap junction
asyl04550  Signaling pathways regulating pluripotency of stem cells
asyl04625  C-type lectin receptor signaling pathway
asyl04650  Natural killer cell mediated cytotoxicity
asyl04660  T cell receptor signaling pathway
asyl04662  B cell receptor signaling pathway
asyl04664  Fc epsilon RI signaling pathway
asyl04714  Thermogenesis
asyl04720  Long-term potentiation
asyl04722  Neurotrophin signaling pathway
asyl04725  Cholinergic synapse
asyl04726  Serotonergic synapse
asyl04730  Long-term depression
asyl04810  Regulation of actin cytoskeleton
asyl04910  Insulin signaling pathway
asyl04912  GnRH signaling pathway
asyl04915  Estrogen signaling pathway
asyl04916  Melanogenesis
asyl04917  Prolactin signaling pathway
asyl04919  Thyroid hormone signaling pathway
asyl04921  Oxytocin signaling pathway
asyl04926  Relaxin signaling pathway
asyl04929  GnRH secretion
asyl04933  AGE-RAGE signaling pathway in diabetic complications
asyl04935  Growth hormone synthesis, secretion and action
asyl05010  Alzheimer disease
asyl05022  Pathways of neurodegeneration - multiple diseases
asyl05034  Alcoholism
asyl05160  Hepatitis C
asyl05161  Hepatitis B
asyl05163  Human cytomegalovirus infection
asyl05165  Human papillomavirus infection
asyl05166  Human T-cell leukemia virus 1 infection
asyl05167  Kaposi sarcoma-associated herpesvirus infection
asyl05170  Human immunodeficiency virus 1 infection
asyl05200  Pathways in cancer
asyl05203  Viral carcinogenesis
asyl05205  Proteoglycans in cancer
asyl05206  MicroRNAs in cancer
asyl05207  Chemical carcinogenesis - receptor activation
asyl05208  Chemical carcinogenesis - reactive oxygen species
asyl05210  Colorectal cancer
asyl05211  Renal cell carcinoma
asyl05213  Endometrial cancer
asyl05214  Glioma
asyl05215  Prostate cancer
asyl05216  Thyroid cancer
asyl05218  Melanoma
asyl05219  Bladder cancer
asyl05220  Chronic myeloid leukemia
asyl05221  Acute myeloid leukemia
asyl05223  Non-small cell lung cancer
asyl05224  Breast cancer
asyl05225  Hepatocellular carcinoma
asyl05226  Gastric cancer
asyl05230  Central carbon metabolism in cancer
asyl05231  Choline metabolism in cancer
asyl05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
asyl05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:asyl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    127682882 (Nras)
   04012 ErbB signaling pathway
    127682882 (Nras)
   04014 Ras signaling pathway
    127682882 (Nras)
   04015 Rap1 signaling pathway
    127682882 (Nras)
   04370 VEGF signaling pathway
    127682882 (Nras)
   04371 Apelin signaling pathway
    127682882 (Nras)
   04068 FoxO signaling pathway
    127682882 (Nras)
   04072 Phospholipase D signaling pathway
    127682882 (Nras)
   04071 Sphingolipid signaling pathway
    127682882 (Nras)
   04151 PI3K-Akt signaling pathway
    127682882 (Nras)
   04150 mTOR signaling pathway
    127682882 (Nras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    127682882 (Nras)
   04137 Mitophagy - animal
    127682882 (Nras)
  09143 Cell growth and death
   04210 Apoptosis
    127682882 (Nras)
   04218 Cellular senescence
    127682882 (Nras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    127682882 (Nras)
   04550 Signaling pathways regulating pluripotency of stem cells
    127682882 (Nras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    127682882 (Nras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    127682882 (Nras)
   04650 Natural killer cell mediated cytotoxicity
    127682882 (Nras)
   04660 T cell receptor signaling pathway
    127682882 (Nras)
   04662 B cell receptor signaling pathway
    127682882 (Nras)
   04664 Fc epsilon RI signaling pathway
    127682882 (Nras)
   04062 Chemokine signaling pathway
    127682882 (Nras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    127682882 (Nras)
   04929 GnRH secretion
    127682882 (Nras)
   04912 GnRH signaling pathway
    127682882 (Nras)
   04915 Estrogen signaling pathway
    127682882 (Nras)
   04917 Prolactin signaling pathway
    127682882 (Nras)
   04921 Oxytocin signaling pathway
    127682882 (Nras)
   04926 Relaxin signaling pathway
    127682882 (Nras)
   04935 Growth hormone synthesis, secretion and action
    127682882 (Nras)
   04919 Thyroid hormone signaling pathway
    127682882 (Nras)
   04916 Melanogenesis
    127682882 (Nras)
  09156 Nervous system
   04725 Cholinergic synapse
    127682882 (Nras)
   04726 Serotonergic synapse
    127682882 (Nras)
   04720 Long-term potentiation
    127682882 (Nras)
   04730 Long-term depression
    127682882 (Nras)
   04722 Neurotrophin signaling pathway
    127682882 (Nras)
  09158 Development and regeneration
   04360 Axon guidance
    127682882 (Nras)
  09149 Aging
   04211 Longevity regulating pathway
    127682882 (Nras)
   04213 Longevity regulating pathway - multiple species
    127682882 (Nras)
  09159 Environmental adaptation
   04714 Thermogenesis
    127682882 (Nras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    127682882 (Nras)
   05206 MicroRNAs in cancer
    127682882 (Nras)
   05205 Proteoglycans in cancer
    127682882 (Nras)
   05207 Chemical carcinogenesis - receptor activation
    127682882 (Nras)
   05208 Chemical carcinogenesis - reactive oxygen species
    127682882 (Nras)
   05203 Viral carcinogenesis
    127682882 (Nras)
   05230 Central carbon metabolism in cancer
    127682882 (Nras)
   05231 Choline metabolism in cancer
    127682882 (Nras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    127682882 (Nras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    127682882 (Nras)
   05225 Hepatocellular carcinoma
    127682882 (Nras)
   05226 Gastric cancer
    127682882 (Nras)
   05214 Glioma
    127682882 (Nras)
   05216 Thyroid cancer
    127682882 (Nras)
   05221 Acute myeloid leukemia
    127682882 (Nras)
   05220 Chronic myeloid leukemia
    127682882 (Nras)
   05218 Melanoma
    127682882 (Nras)
   05211 Renal cell carcinoma
    127682882 (Nras)
   05219 Bladder cancer
    127682882 (Nras)
   05215 Prostate cancer
    127682882 (Nras)
   05213 Endometrial cancer
    127682882 (Nras)
   05224 Breast cancer
    127682882 (Nras)
   05223 Non-small cell lung cancer
    127682882 (Nras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    127682882 (Nras)
   05170 Human immunodeficiency virus 1 infection
    127682882 (Nras)
   05161 Hepatitis B
    127682882 (Nras)
   05160 Hepatitis C
    127682882 (Nras)
   05163 Human cytomegalovirus infection
    127682882 (Nras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    127682882 (Nras)
   05165 Human papillomavirus infection
    127682882 (Nras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    127682882 (Nras)
   05022 Pathways of neurodegeneration - multiple diseases
    127682882 (Nras)
  09165 Substance dependence
   05034 Alcoholism
    127682882 (Nras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    127682882 (Nras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    127682882 (Nras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    127682882 (Nras)
   01522 Endocrine resistance
    127682882 (Nras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:asyl04131]
    127682882 (Nras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asyl04147]
    127682882 (Nras)
   04031 GTP-binding proteins [BR:asyl04031]
    127682882 (Nras)
Membrane trafficking [BR:asyl04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    127682882 (Nras)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    127682882 (Nras)
Exosome [BR:asyl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   127682882 (Nras)
  Exosomal proteins of other body fluids (saliva and urine)
   127682882 (Nras)
  Exosomal proteins of breast cancer cells
   127682882 (Nras)
  Exosomal proteins of colorectal cancer cells
   127682882 (Nras)
GTP-binding proteins [BR:asyl04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    127682882 (Nras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 127682882
NCBI-ProteinID: XP_052035576
LinkDB
Position
4:complement(60833984..60844570)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgctttgaca
atccagcttatccagaaccattttgtggatgaatatgatcccaccatagaggattcctac
cgaaaacaagtggtgattgacggtgagacctgtctgctggacatactggacacagctgga
caagaggagtacagtgccatgagagaccagtacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaagtcatttgcagatattaacctctacagagagcaaatt
aagcgagtgaaagactctgatgatgtccccatggtgctggtagggaacaagtgtgacttg
ccaacaaggaccgttgacacaaagcaagcccacgagctggccaagagttacggaattcca
ttcattgaaacctcagccaagacccgccagggtgtggaagatgccttttatacactcgta
agggagatacgccagtaccgaatgaaaaagctcaacagcagtgatgacggcactcaaggt
tgtatgggactgccctgtgtggtgatgtag

DBGET integrated database retrieval system