KEGG   Aethina tumida (small hive beetle): 109593892
Entry
109593892         CDS       T06105                                 
Name
(RefSeq) LOW QUALITY PROTEIN: cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:atd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    109593892
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:atd00199]
    109593892
Enzymes [BR:atd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     109593892
Cytochrome P450 [BR:atd00199]
 Cytochrome P450, animal type
  CYP306 family
   109593892
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 109593892
NCBI-ProteinID: XP_019864580
LinkDB
Position
Unknown
AA seq 490 aa
MCYSLVAVAIFVLCFYVYKSYYKSAPGPWNLPIVGALPRLDPKQPHVTLTRWAKEYGPVY
GLKLGSVYTVVMTDPRTIRNVFCKDATTGRAPLYLTHGIMNGYGLICAEGERWKDQRKFI
HHALRQFGASKIGKRDKMEQLIMENALDFVKFVKEKGKEVRLDPLEGLRHSLGSVINDIV
FGKSWSRDDETWKWLQHLQEEGTKHIGVAGPLNFLSFLIKIPMYRRTMDFLMEGKLETHK
VYQQLIDEQEKFMKSVDYASNENLIQAFLQERHRRNGTNNEYYCDQQFYHLLADVFGAGL
DTTLTTMRWYLLYMATNSEIQKAVRSQINEMVPNSNLSLNDLWKLPLVEASIMEAQRIRS
VVPVGIPHGSLDYLEIGGYKVPPNTMLIPLQWAIHMNEDIFPDPERFDPHRFLDEDGNLC
RNDYFMPFQTGKRMCIGDELARMLLFLFCATIVQNFELSVEDLKKVDLTGDCGITLTPKP
QKIIFKDLYM
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgtgctacagtttggtcgcggtggccatcttcgtcttgtgcttctacgtctacaagtcg
tactacaaatcggcgccgggtccgtggaacctgccgatagtcggcgcgttgccgcgcctg
gacccgaaacagccccacgtgacgttgacgagatgggcgaaggaatacgggccggtgtac
gggctgaagctgggcagcgtgtacacggtcgtgatgaccgatccgcggacgatacggaac
gtcttctgcaaggacgcgacgaccggaagggcgccgctttatctcacgcacggcatcatg
aacggatatggtttgatttgtgccgagggtgaaagatggaaagaccaacggaaattcatc
caccacgccttaagacaattcggggcgtcgaaaatcggaaaacgagacaaaatggaacaa
ctaatcatggaaaatgccttagattttgtcaaattcgtcaaagagaaaggtaaagaagta
cgtcttgatcctttggaaggcttaagacacagcttagggtcagtcataaacgacatagtt
tttggaaaatcgtggagtcgagacgacgaaacttggaagtggttgcaacatttgcaggaa
gaaggaacgaaacatattggagttgcaggacctctcaatttcctctctttcttaatcaaa
attccaatgtaccgcagaacaatggatttcttaatggagggaaaattggaaactcataaa
gtctatcaacaattgatcgatgagcaagagaaattcatgaaaagtgtcgactatgcatcg
aacgaaaacttaatccaggcattcctgcaagagagacatagaagaaacggaaccaataac
gaatattactgcgaccagcagttctaccatttgttagctgatgtctttggagccggttta
gataccaccctaaccactatgagatggtacttgttgtacatggccacaaattcggaaata
caaaaagctgtcagatctcaaatcaatgaaatggtaccaaatagcaacttatccctcaac
gacttatggaaactaccattggtcgaggcgtccattatggaggctcaaagaatcagatcg
gtagtaccagttggaataccacacggctctttggactatttagaaatagggggttacaag
gtaccaccgaacactatgttgatacccttgcagtgggccatacacatgaacgaagacatt
ttccccgaccccgaacgatttgacccccacaggtttttggatgaagatggtaatttgtgc
aggaacgattattttatgccctttcaaacaggcaaacgtatgtgtattggcgacgaattg
gccagaatgttattgttccttttctgtgctacgattgttcaaaattttgagttgagcgtt
gaagatttgaagaaggtcgatttaactggagactgtggaataactttgactcctaaacct
caaaaaattatttttaaagatctgtacatgtga

DBGET integrated database retrieval system