KEGG   Arabidopsis thaliana (thale cress): AT1G04400
Entry
AT1G04400         CDS       T00041                                 

Symbol
CRY2
Name
(RefSeq) cryptochrome 2
  KO
K12119  cryptochrome 2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT1G04400 (CRY2)
SSDB
Motif
Pfam: FAD_binding_7 DNA_photolyase SR-25
Other DBs
NCBI-GeneID: 839529
NCBI-ProteinID: NP_171935
TAIR: AT1G04400
UniProt: Q96524 G4WTR2
LinkDB
Position
1:complement(1185512..1188696)
AA seq 612 aa
MKMDKKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRWWMKQSL
AHLSQSLKALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLV
ERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSIESVMLPPPWRLMPITAA
AEAIWACSIEELGLENEAEKPSNALLTRAWSPGWSNADKLLNEFIEKQLIDYAKNSKKVV
GNSTSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGEESADLFLRGIGLREYSRYI
CFNFPFTHEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRV
IVSSFAVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGSIPDGHELDRLDNPALQG
AKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKPIVDIDTAREL
LAKAISRTREAQIMIGAAPDEIVADSFEALGANTIKEPGLCPSVSSNDQQVPSAVRYNGS
KRVKPEEEEERDMKKSRGFDERELFSTAESSSSSSVFFVSQSCSLASEGKNLEGIQDSSD
QITTSLGKNGCK
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgaagatggacaaaaagactatagtttggtttagaagagacctaaggattgaggataat
cctgcattagcagcagctgctcacgaaggatctgtttttcctgtcttcatttggtgtcct
gaagaagaaggacagttttatcctggaagagcttcaagatggtggatgaaacaatcactt
gctcacttatctcaatccttgaaggctcttggatctgacctcactttaatcaaaacccac
aacacgatttcagcgatcttggattgtatccgcgttaccggtgctacaaaagtcgtcttt
aaccacctctatgatcctgtttcgttagttcgggaccataccgtaaaggagaagctggtg
gaacgtgggatctctgtgcaaagctacaatggagatctattgtatgaaccgtgggagata
tactgcgaaaagggcaaaccttttacgagtttcaattcttactggaagaaatgcttagat
atgtcgattgaatccgttatgcttcctcctccttggcggttgatgccaataactgcagcg
gctgaagcgatttgggcgtgttcgattgaagaactagggctggagaatgaggccgagaaa
ccgagcaatgcgttgttaactagagcttggtctccaggatggagcaatgctgataagtta
ctaaatgagttcatcgagaagcagttgatagattatgcaaagaacagcaagaaagttgtt
gggaattctacttcactactttctccgtatctccatttcggggaaataagcgtcagacac
gttttccagtgtgcccggatgaaacaaattatatgggcaagagataagaacagtgaagga
gaagaaagtgcagatctttttcttaggggaatcggtttaagagagtattctcggtatata
tgtttcaacttcccgtttactcacgagcaatcgttgttgagtcatcttcggtttttccct
tgggatgctgatgttgataagttcaaggcctggagacaaggcaggaccggttatccgttg
gtggatgccggaatgagagagctttgggctaccggatggatgcataacagaataagagtg
attgtttcaagctttgctgtgaagtttcttctccttccatggaaatggggaatgaagtat
ttctgggatacacttttggatgctgatttggaatgtgacatccttggctggcagtatatc
tctgggagtatccccgatggccacgagcttgatcgcttggacaatcccgcgttacaaggc
gccaaatatgacccagaaggtgagtacataaggcaatggcttcccgagcttgcgagattg
ccaactgaatggatccatcatccatgggacgctcctttaaccgtactcaaagcttctggt
gtggaactcggaacaaactatgcgaaacccattgtagacatcgacacagctcgtgagcta
ctagctaaagctatttcaagaacccgtgaagcacagatcatgatcggagcagcacctgat
gagattgtagcagatagcttcgaggccttaggggctaataccattaaagaacctggtctt
tgcccatctgtgtcttctaatgaccaacaagtaccttcggctgttcgttacaacgggtca
aagagagtgaaacctgaggaagaagaagagagagacatgaagaaatctaggggattcgat
gaaagggagttgttttcgactgctgaatcttcttcttcttcgagtgtgtttttcgtttcg
cagtcttgctcgttggcatcagaagggaagaatctggaaggtattcaagattcatctgat
cagattactacaagtttgggaaaaaatggttgcaaatga

KEGG   Arabidopsis thaliana (thale cress): AT4G08920
Entry
AT4G08920         CDS       T00041                                 

Symbol
CRY1
Name
(RefSeq) cryptochrome 1
  KO
K12118  cryptochrome 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT4G08920 (CRY1)
SSDB
Motif
Pfam: FAD_binding_7 DNA_photolyase Cryptochrome_C
Other DBs
NCBI-GeneID: 826470
NCBI-ProteinID: NP_567341
TAIR: AT4G08920
UniProt: Q43125
LinkDB
Structure
PDB: 
1U3D 1U3C

Position
4:5723651..5727268
AA seq 681 aa
MSGSVSGCGSGGCSIVWFRRDLRVEDNPALAAAVRAGPVIALFVWAPEEEGHYHPGRVSR
WWLKNSLAQLDSSLRSLGTCLITKRSTDSVASLLDVVKSTGASQIFFNHLYDPLSLVRDH
RAKDVLTAQGIAVRSFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDPESPLLPPK
KIISGDVSKCVADPLVFEDDSEKGSNALLARAWSPGWSNGDKALTTFINGPLLEYSKNRR
KADSATTSFLSPHLHFGEVSVRKVFHLVRIKQVAWANEGNEAGEESVNLFLKSIGLREYS
RYISFNHPYSHERPLLGHLKFFPWAVDENYFKAWRQGRTGYPLVDAGMRELWATGWLHDR
IRVVVSSFFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYITGTLPDSREFDRIDNPQ
FEGYKFDPNGEYVRRWLPELSRLPTDWIHHPWNAPESVLQAAGIELGSNYPLPIVGLDEA
KARLHEALSQMWQLEAASRAAIENGSEEGLGDSAEVEEAPIEFPRDITMEETEPTRLNPN
RRYEDQMVPSITSSLIRPEEDEESSLNLRNSVGDSRAEVPRNMVNTNQAQQRRAEPASNQ
VTAMIPEFNIRIVAESTEDSTAESSSSGRRERSGGIVPEWSPGYSEQFPSEENGIGGGST
TSSYLQNHHEILNWRRLSQTG
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgtctggttctgtatctggttgtggttctggtggttgtagtattgtatggtttagaaga
gatcttagggttgaagataatccagctttagcagcagcagtaagagctggtccagtgatt
gctctgtttgtttgggcaccagaagaagaaggacactatcatccaggtagggtttctagg
tggtggctcaagaacagtttggctcagcttgattcttctcttagaagtcttggtacttgt
cttatcaccaagagatctactgatagtgttgcttctcttcttgatgttgttaaatccact
ggtgcttctcagatcttcttcaaccatttgtatgatccattgtctttggtgcgtgatcac
cgagctaaagatgttttgacggcgcaaggcatagcggttcgatcattcaacgcagacttg
ctttatgagccatgggaagtgactgatgaattaggccgtcctttctctatgtttgctgcg
ttttgggagagatgtcttagtatgccttatgaccctgagtctcctcttcttccacctaag
aagatcatttcaggggatgtgtctaaatgtgttgcggatccattggtgtttgaggatgac
tctgagaaaggaagcaatgcacttctggctcgtgcttggtctcctggatggagtaatggt
gataaagctctcacaacgtttataaacggtccattgcttgaatactctaagaaccgcaga
aaagccgatagtgctacaacctcgtttctttctccacacttgcattttggggaagtgagt
gtgagaaaagtttttcatcttgttcggatcaaacaggtcgcgtgggcaaacgaaggaaac
gaggccggggaagaaagcgtgaatcttttcctgaaatctattggtctcagggagtattct
aggtacataagttttaaccatccatattcccatgaaagaccacttcttggccatctaaag
ttcttcccttgggctgtggatgagaactatttcaaggcatggaggcaaggccggactgga
tatccgttggtcgatgccgggatgagagagttatgggctactggttggttgcatgatcgc
ataagagtagttgtttcaagcttctttgttaaagtgcttcaattaccatggagatggggg
atgaagtatttctgggacacacttcttgatgcggatttagaaagcgatgctcttggttgg
caatacattaccggtactctcccggatagccgggagtttgatcgcatagataaccctcag
tttgaagggtacaagtttgatccaaatggtgaatacgtaaggcgatggcttcctgaactc
tctagactcccgacagactggatacatcatccgtggaacgcacctgagtccgttcttcaa
gctgctggtatcgagcttggatcaaactatcctctaccaattgtaggattagacgaagca
aaagcacggcttcatgaagcgctttcacagatgtggcaactagaagctgcttcaagagct
gcaatagagaacggatccgaagaaggacttggagattctgctgaggtagaggaagctcct
atagagttcccaagggacattacaatggaagagactgaaccaaccagactcaacccaaac
aggagatatgaggatcagatggttccaagcattacttcttctttgatcagacctgaagaa
gacgaagagtcgtctcttaatttgagaaattcagtaggagatagcagagcagaggttcca
aggaacatggttaacaccaaccaagctcagcagcggagagcagaaccggcttcaaaccaa
gtcactgctatgattccagaatttaatatcagaattgttgcagagagcactgaagactca
acagcggaatcttccagcagcggaaggagagaaagaagcggaggcatagtccccgagtgg
tctccagggtactcagagcagttccctagtgaagaaaatggtattggaggaggaagtaca
acgtctagctacttgcagaatcaccatgaaatactgaactggagacggctttcacaaacc
gggtaa

DBGET integrated database retrieval system