KEGG   Arabidopsis thaliana (thale cress): AT1G04710
Entry
AT1G04710         CDS       T00041                                 
Symbol
PKT4
Name
(RefSeq) peroxisomal 3-ketoacyl-CoA thiolase 4
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00280  Valine, leucine and isoleucine degradation
ath00592  alpha-Linolenic acid metabolism
ath01040  Biosynthesis of unsaturated fatty acids
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT1G04710 (PKT4)
   00592 alpha-Linolenic acid metabolism
    AT1G04710 (PKT4)
   01040 Biosynthesis of unsaturated fatty acids
    AT1G04710 (PKT4)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT1G04710 (PKT4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT1G04710 (PKT4)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     AT1G04710 (PKT4)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Other DBs
NCBI-GeneID: 839434
NCBI-ProteinID: NP_171965
TAIR: AT1G04710
UniProt: Q8LF48 A0A178W7T5
LinkDB
Position
1:1321885..1324840
AA seq 443 aa
MEKATERQRILLRHLQPSSSSDASLSASACLSKDSAAYQYGDDVVIVAAQRTALCKAKRG
SFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMAAFYAGFPET
VPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNPNVKKFEQ
AHNCLLPMGITSENVAHRFNVSREEQDQAAVDSHRKAASATASGKFKDEITPVKTKIVDP
KTGDEKPITVSVDDGIRPNTTLSGLAKLKPVFKEDGTTTAGNSSQLSDGAGAVLLMRRNV
AMQKGLPILGVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLELNDVDLFEINEAFASQF
VYCRNKLGLDAEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGS
GMGAAAVFERGGGVDELCDVRKV
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggaaaaagcaacggagagacaaaggatactgcttcgtcatcttcaaccttcgtcatct
tccgacgcctctctctctgcctcagcttgcttgtccaaagacagtgctgcatatcaatat
ggagatgatgttgtcattgtcgcggcacaaaggactgcactttgcaaggcaaaacgtggc
agcttcaaggatacatttccagacgagttgcttgcctctgtattgagagcattgatagag
aaaactaatgtaaacccaagtgaagttggtgacattgtagtgggtactgttttgggacca
ggatctcagagagccagtgaatgcaggatggctgcgttctatgctggtttccccgaaact
gttcccatcagaaccgtgaacagacagtgttcatctgggcttcaggctgttgctgatgtt
gccgctgccataaaagctggtttttatgacattggtattggagctgggctggagtccatg
acaactaatccaaggggatggaaaggatcagtcaacccaaatgtgaagaagtttgaacaa
gctcacaattgccttcttccaatgggtattacttcagaaaatgtagcacaccggtttaat
gtttcaagggaggagcaggatcaagctgctgttgattctcacagaaaggctgcttctgct
actgcttccggaaagtttaaggatgagataacccctgtaaaaaccaagattgttgaccca
aagacaggtgatgagaaacccataacagtttctgtggatgatgggattcgacctaacaca
accctttccggacttgcaaagctgaagccagtgtttaaggaagacggaaccacaactgct
gggaattctagccaattaagtgacggtgctggagctgttctccttatgaggagaaatgtc
gcaatgcagaaaggccttcccattcttggtgtattcaggacattttctgcagttggtgtg
gacccagccatcatgggggttgggccagccgttgccattcctgctgcagtcaaggcagct
ggtttagaactcaatgacgtcgacttgtttgagattaacgaggcatttgcatctcagttt
gtttattgtcggaacaagctcgggctagacgcggaaaagatcaatgtcaatggaggagcc
atagccattggacatcccttgggcgctacaggagccagatgcgttgcgacgctgctgcat
gagatgaaacgacgtggtaaagactgtcgttttggcgtagtgtcaatgtgtataggttcg
ggaatgggagcagccgctgtgtttgagagaggaggcggtgtggatgagctctgtgatgtc
cggaaagtctaa

KEGG   Arabidopsis thaliana (thale cress): AT2G33150
Entry
AT2G33150         CDS       T00041                                 
Symbol
PKT3
Name
(RefSeq) peroxisomal 3-ketoacyl-CoA thiolase 3
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00280  Valine, leucine and isoleucine degradation
ath00592  alpha-Linolenic acid metabolism
ath01040  Biosynthesis of unsaturated fatty acids
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT2G33150 (PKT3)
   00592 alpha-Linolenic acid metabolism
    AT2G33150 (PKT3)
   01040 Biosynthesis of unsaturated fatty acids
    AT2G33150 (PKT3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT2G33150 (PKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT2G33150 (PKT3)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     AT2G33150 (PKT3)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Other DBs
NCBI-GeneID: 817876
NCBI-ProteinID: NP_180873
TAIR: AT2G33150
UniProt: Q56WD9 A0A178VRP9
Structure
LinkDB
Position
2:complement(14047478..14051400)
AA seq 462 aa
MEKAIERQRVLLEHLRPSSSSSHNYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRT
PLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAA
FYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVN
PAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIP
VKTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGNSSQVSDGAGA
VLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEI
NEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFG
VVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggagaaagcgatcgagagacaacgcgttcttcttgagcatctccgaccttcttcttct
tcttcgcacaattacgaggcttctctatctgcttctgcttgcttggctggggacagtgct
gcatatcagaggacctctctctatggagatgatgttgtcattgtcgcggcacataggact
ccactatgcaagtccaaacgtggcaatttcaaggatacatatcccgatgatttgctcgca
cctgttttgagggcattgatagagaagacgaatctaaacccaagtgaagtaggtgacatt
gttgtgggtactgttttggcacctggatctcagagagccagtgaatgcaggatggctgcg
ttctatgctggtttccctgaaaccgtggctgtcagaactgtgaatagacagtgctcatct
gggcttcaggctgttgctgatgtagccgctgccattaaagcgggattttatgacattggt
atcggggctggtttggagtccatgactaccaatccaatggcatgggaagggtcagtcaac
ccagcggtgaagaagtttgcacaagcgcagaattgtcttcttcctatgggtgttacgtca
gaaaatgtagcacaacgctttggtgtctcaaggcaggagcaagatcaagctgctgttgac
tcgcacagaaaggcagctgctgctactgctgctggtaaattcaaggatgagatcattcct
gttaagaccaagcttgttgacccgaagactggtgatgagaaacccattacagtttctgtt
gatgatggtatccgaccaaccacaactcttgcttctcttgggaagctgaagccagtgttt
aagaaggatggcaccactactgctggaaattccagccaagtaagtgatggtgcaggagcg
gttctcctaatgaagagaagtgttgcaatgcaaaaaggacttcccgttcttggtgtattc
aggacatttgctgcagttggtgttgaccctgcaatcatgggtatcggtccagcagttgcc
attcctgctgcagttaaggcggctggtttagaacttgatgacatcgacttgtttgagatc
aatgaggcatttgcatctcagtttgtttattgccgtaacaaattgggacttgacccagag
aaaatcaatgtcaacggaggtgcaatggccataggccatcctttgggcgctacaggagcg
cgttgtgttgctacattgttgcacgagatgaaacgccgtggtaaagactgccgttttgga
gtagtgtcaatgtgcattgggacggggatgggtgcagcagctgtgtttgagagaggagat
ggagttgatgagcttcgcaacgcaaggaaagttgaagcgcaaggtcttttgtccaaggac
gctcgctag

KEGG   Arabidopsis thaliana (thale cress): AT5G48880
Entry
AT5G48880         CDS       T00041                                 
Symbol
KAT5
Name
(RefSeq) peroxisomal 3-keto-acyl-CoA thiolase 2
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00280  Valine, leucine and isoleucine degradation
ath00592  alpha-Linolenic acid metabolism
ath01040  Biosynthesis of unsaturated fatty acids
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT5G48880 (KAT5)
   00592 alpha-Linolenic acid metabolism
    AT5G48880 (KAT5)
   01040 Biosynthesis of unsaturated fatty acids
    AT5G48880 (KAT5)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT5G48880 (KAT5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT5G48880 (KAT5)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     AT5G48880 (KAT5)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Other DBs
NCBI-GeneID: 834946
NCBI-ProteinID: NP_001331840
TAIR: AT5G48880
UniProt: Q570C8 A0A178UEC0
LinkDB
Position
5:complement(19814395..19817955)
AA seq 457 aa
MERAMERQKILLRHLNPVSSSNSSLKHEPSLLSPVNCVSEVSPMAAFGDDIVIVAAYRTA
ICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY
FAGFPDSVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDHIPGGGFHGS
NPRAQDFPKARDCLLPMGITSENVAERFGVTREEQDMAAVESHKRAAAAIASGKLKDEII
PVATKIVDPETKAEKAIVVSVDDGVRPNSNMADLAKLKTVFKQNGSTTAGNASQISDGAG
AVLLMKRSLAMKKGLPILGVFRSFAVTGVEPSVMGIGPAVAIPAATKLAGLNVSDIDLFE
INEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRF
GVISMCIGTGMGAAAVFERGDSVDNLSNARVANGDSH
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggagagagctatggaaagacaaaagatattgcttcgtcatctcaatccagtttcttct
tctaattcttctcttaaacatgaaccttctcttctgtctcctgtgaattgtgtttctgaa
gtttccccaatggctgcttttggagatgacattgtgattgtagcggcatatcgtaccgcc
atttgcaaagcgagacgtggaggtttcaaagacactcttcctgatgatcttcttgcttct
gttcttaaggctgtagtggaaagaacatctttggatccaagtgaagttggtgatatcgtt
gttggtaccgtgatagcgcctggttctcagagagcaatggagtgtagagttgcagcttat
tttgctggttttcctgactccgtgccagttagaactgtcaatagacaatgctcatcagga
ctacaagcagttgctgatgttgctgcttccattagagctggttattacgacattggtatt
ggtgctggagtggaatcaatgtcaactgatcatattcctggaggcggctttcatggctct
aatccaagagcacaggatttcccaaaagcccgtgattgtttgcttccaatgggaattact
tctgaaaacgttgcagaaaggttcggtgtcacaagagaagagcaagatatggctgcggtg
gagtctcacaaacgcgctgcagctgcaatcgcgtctggtaaactcaaggatgaaatcatt
cctgttgctactaagattgtggaccctgagactaaagcagagaaggcaatcgtcgtatct
gttgatgacggtgtacgtccaaactcaaacatggcagatttggcaaagctgaagactgtc
tttaaacagaacggttccaccacagctggcaatgctagtcagatcagtgatggtgctgga
gcagtactgctaatgaagagaagtttggctatgaagaagggacttcccattcttggagta
ttcaggagttttgctgttactggtgtggaaccatctgtaatgggtattggtccagctgtt
gccattcccgctgcaactaagctcgcagggctcaacgtcagcgatattgatctattcgag
atcaatgaggcatttgcatctcagtatgtgtactcttgcaagaagttagagctggatatg
gaaaaggtcaatgttaatggaggagccattgctattggccatcccctgggtgctacagga
gctcgatgtgttgcgacattgttgcacgagatgaagcggagaggaaaagattgccgcttt
ggagtaatctcaatgtgcataggcactggaatgggagctgcagctgtttttgagagggga
gactctgttgataacttgtccaacgctcgtgtggctaacggggatagtcattag

DBGET integrated database retrieval system