KEGG   Arabidopsis thaliana (thale cress): AT1G06290
Entry
AT1G06290         CDS       T00041                                 
Symbol
ACX3
Name
(RefSeq) acyl-CoA oxidase 3
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00410  beta-Alanine metabolism
ath00592  alpha-Linolenic acid metabolism
ath00640  Propanoate metabolism
ath01040  Biosynthesis of unsaturated fatty acids
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AT1G06290 (ACX3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT1G06290 (ACX3)
   00592 alpha-Linolenic acid metabolism
    AT1G06290 (ACX3)
   01040 Biosynthesis of unsaturated fatty acids
    AT1G06290 (ACX3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT1G06290 (ACX3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT1G06290 (ACX3)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     AT1G06290 (ACX3)
SSDB
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 DUF4402 Acyl-CoA_ox_N
Other DBs
NCBI-GeneID: 837140
NCBI-ProteinID: NP_172119
TAIR: AT1G06290
UniProt: P0CZ23 A0A178WDE4
LinkDB
Position
1:1922208..1926278
AA seq 675 aa
MSDNRALRRAHVLANHILQSNPPSSNPSLSRELCLQYSPPELNESYGFDVKEMRKLLDGH
NVVDRDWIYGLMMQSNLFNRKERGGKIFVSPDYNQTMEQQREITMKRIWYLLENGVFKGW
LTETGPEAELRKLALLEVCGIYDHSVSIKVGVHFFLWGNAVKFFGTKRHHEKWLKNTEDY
VVKGCFAMTELGHGSNVRGIETVTTYDPKTEEFVINTPCESAQKYWIGGAANHATHTIVF
SQLHINGTNQGVHAFIAQIRDQDGSICPNIRIADCGHKIGLNGVDNGRIWFDNLRIPREN
LLNAVADVSSDGKYVSSIKDPDQRFGAFMAPLTSGRVTIASSAIYSAKVGLSIAIRYSLS
RRAFSVTANGPEVLLLDYPSHQRRLLPLLAKTYAMSFAANELKMIYVKRTPETNKAIHVV
SSGFKAVLTWHNMHTLQECREAVGGQGVKTENLVGQLKGEFDVQTTFEGDNNVLMQQVSK
ALFAEYVSCKKRNKPFKGLGLEHMNSPRPVLPTQLTSSTLRCSQFQTNVFCLRERDLLEQ
FTSEVAQLQGRGESREFSFLLSHQLAEDLGKAFTEKAILQTILDAEAKLPTGSVKDVLGL
VRSMYALISLEEDPSLLRYGYLSQDNVGDVRREVSKLCGELRPHALALVTSFGIPDSFLS
PIAFNWVEANAWSSV
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgtcggataatcgtgcactccgacgagctcatgttctcgccaatcacatactccaatca
aatcctccatcttcgaacccgtccctgtcgcgcgagttatgtttgcagtactctccaccg
gagctcaacgagagctatggattcgatgtcaaggagatgagaaaattacttgacggacac
aacgtggtggatcgggactggatttatggactcatgatgcagagcaatctgtttaatcgg
aaggagagaggaggtaagattttcgtgtcgccggattacaatcagacgatggagcagcag
cgtgagatcacaatgaaacggatctggtacttgcttgagaatggggttttcaaaggatgg
ttgacggagacaggtcctgaggccgagctcaggaaattagctctgcttgaggtttgcggg
atttatgatcactccgtctccatcaaagttggtgtgcatttcttcctgtggggtaatgct
gtaaagttttttggaacaaagcgtcaccatgaaaagtggctgaagaacaccgaagattat
gttgtcaagggctgttttgctatgactgagctaggccatggaagtaatgtacggggaatt
gaaacagtgacaacttatgacccaaaaactgaagagtttgtgataaatactccttgtgaa
tctgctcagaagtattggattggtggggcagctaatcatgcaacccacacaattgtgttt
tcacagcttcatatcaacggaaccaaccagggggtccatgcctttatcgcccaaatcagg
gatcaagatggcagcatatgtccaaatatccgcattgctgactgtggacacaaaattggt
ctaaatggtgttgacaatggccggatctggtttgataatcttcgaattccaagagagaat
ttgttgaatgcagttgctgatgtttcgtctgatgggaagtatgttagctcaattaaagat
cctgatcagagatttggagcattcatggcccctttgacttctggccgagtcacaattgca
tcaagtgcaatttattctgcaaaggtcggattatctattgctataaggtactcattatcg
agaagagccttctctgttacagctaatggtcctgaagtcctcctccttgattacccaagc
catcaaaggcgactgctaccactcctagcaaagacatatgctatgagttttgctgcaaat
gaattgaagatgatttacgtgaagagaacaccggagaccaacaaagccatccacgttgtt
tcaagtgggttcaaagctgttctcacctggcacaatatgcacacacttcaggaatgtcga
gaagctgtcggagggcaaggtgtgaaaacagaaaatctagttggtcagttgaaaggtgaa
tttgatgtgcagactacatttgagggtgacaataatgtattgatgcagcaggtgagcaag
gcgcttttcgctgaatatgtatcgtgtaagaagagaaacaaacctttcaagggactggga
ttggagcacatgaacagtccacgtcctgtattaccgactcaactcacatcatcaaccctc
agatgcagccaattccagacaaatgtgttctgcttaagagagcgagatcttctggagcaa
tttacttctgaagttgcacagcttcaagggagaggagaaagtcgagaattctctttcctc
ctgagtcatcaacttgctgaagacttaggtaaagctttcacagagaaagcaatacttcaa
accattttggatgctgaggcaaaactacctactggctcagtaaaggatgtgttgggtctt
gtaagatcaatgtacgcattgatcagcttggaagaagatccatcgttgctgcgatatggt
tacctatctcaggataatgttggagatgtgaggagagaagtttcaaagctctgtggagag
cttagaccacacgcgcttgcactcgtcacttcattcggcattccagactccttcttgagt
ccaattgcattcaactgggtcgaagccaatgcttggtcttcagtttag

KEGG   Arabidopsis thaliana (thale cress): AT1G06310
Entry
AT1G06310         CDS       T00041                                 
Symbol
ACX6
Name
(RefSeq) acyl-CoA oxidase 6
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00410  beta-Alanine metabolism
ath00592  alpha-Linolenic acid metabolism
ath00640  Propanoate metabolism
ath01040  Biosynthesis of unsaturated fatty acids
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AT1G06310 (ACX6)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT1G06310 (ACX6)
   00592 alpha-Linolenic acid metabolism
    AT1G06310 (ACX6)
   01040 Biosynthesis of unsaturated fatty acids
    AT1G06310 (ACX6)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT1G06310 (ACX6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT1G06310 (ACX6)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     AT1G06310 (ACX6)
SSDB
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N
Other DBs
NCBI-GeneID: 837141
NCBI-ProteinID: NP_172120
TAIR: AT1G06310
UniProt: Q9LMI7 A0A654E9A3
LinkDB
Position
1:1926652..1930397
AA seq 675 aa
MSENVELRRAHILANHILRSPRPSSNPSLTPEVCFQYSPPELNESYGFEVKEMRKLLDGH
NLEERDWLYGLMMQSNLFNPKQRGGQIFVSPDYNQTMEQQRQISMKRIFYLLEKGVFQGW
LTETGPEAELKKFALYEVCGIYDYSLSAKLGVHFLLWGNAVKFFGTKRHHEKWLKDTEDY
VVKGCFAMTELGHGTNVRGIETVTTYDPTTEEFVINTPCESAQKYWIGEAANHANHAIVI
SQLSMNGTNQGIHVFIAQIRDHDGNTCPNVRIADCGHKIGLNGVDNGRIWFDNLRIPREN
LLNSVADVLADGKYVSSIKDPDQRFGAFLAPLTSGRVTIASSAIYSAKLGLAVAIRYSLS
RRAFSVAANGPEVLLLDYPSHQRRLLPLLAKTYAMSFAVNDLKMIYVKRTPETNKAIHVV
SSGFKAVLTWHNMRTLQECREAVGGQGLKTENRVGHLKGEYDVQTTFEGDNNVLMQLVSK
ALFAEYVSCKKRNKPFKGLGLEHMNSPRPVLPTQLTSSTLRCSQFQKSVFCLRERDLLER
FTSEVAELQGRGESREFLFLLNHQLSEDLSKAFTEKAILQTVLDAEAKLPPGSVKDVLGL
VRSMYALISLEEDPSLLRYGHLSRDNVGDVRKEVSKLCGELRPHALALVASFGIPDAFLS
PIAFNWVEANAWSSL
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgtccgaaaatgttgaactccggcgagcccatattctcgctaatcacatactccgttca
cctcggccttcttcaaacccctccctcacgccggaagtatgttttcagtactctccaccg
gagctcaacgagagctatggattcgaagtcaaggagatgagaaaactactcgacggacac
aacttagaggaaagagactggctttatgggctcatgatgcagagcaatctgtttaacccg
aaacagagaggaggtcagattttcgtctcgcccgattacaatcaaacaatggagcaacag
cgccagatcagtatgaagcggatcttttacttgctcgaaaaaggggtctttcaaggatgg
ctaacggagacaggtcctgaagctgagctcaagaagtttgctctctacgaagtttgcggg
atttatgattactccctctccgccaaactcggtgttcacttcttgttgtggggtaatgct
gttaagttctttgggacaaagcgtcaccatgaaaagtggctgaaagacactgaagattat
gttgtcaagggctgctttgcaatgactgagctaggccatggaactaatgtacggggaatt
gaaacagtgactacttatgacccaacaactgaagagtttgtgataaatactccttgtgaa
tctgctcagaagtattggatcggtgaggcagctaaccatgcaaaccatgcaattgtgatt
tctcagcttagtatgaatgggaccaaccaggggattcatgtctttattgctcaaatcaga
gatcatgatggcaacacatgtcctaacgtccgcatagctgactgtggacacaaaattggt
ttgaatggtgttgacaatggccgtatatggtttgacaatcttcgaattccaagagagaat
ttattgaactcagttgctgatgttttagctgatgggaagtatgttagctcaattaaagat
cctgatcagagatttggagcattcttggcccctttgacatctggtcgtgtcacaattgct
tcaagtgcaatttattctgcaaagctcggattagctgttgctattagatactcactatcg
agaagagccttctcagttgcagccaatggtcctgaagttctccttcttgattatccaagc
catcaaagacgacttttaccactcctagcaaagacatatgctatgagttttgctgtaaat
gacttgaagatgatttacgtgaagaggacacctgagaccaacaaagccatccatgtcgtt
tcaagtggattcaaagctgttctcacttggcacaatatgcgaacgcttcaggaatgtcgt
gaagctgttggaggccaaggtttgaaaacagaaaaccgagtaggtcatttaaaaggagaa
tatgatgtgcagactacatttgagggtgacaataatgtactcatgcagctggtgagcaag
gcactttttgctgaatatgtatcgtgtaagaagagaaataaacctttcaaaggattggga
ttggagcacatgaacagtccacgtcctgtattgccgactcaactcacatcatctacacta
agatgcagccagttccagaaaagtgtgttttgcttaagagagcgagatcttctagaacgg
tttacttctgaagttgcagagcttcaagggagaggagaaagcagagagttcttattcctt
ttgaatcatcaactttctgaagacttaagtaaagctttcacagaaaaagcaatactgcaa
accgttttggatgctgaggccaaattgcctcctggctcagttaaggatgtgttgggtctt
gtaagatcaatgtacgcattgatcagcttggaagaagatccatcgctgctaagatatggt
cacctctcaagggataatgttggagatgtgaggaaagaagtttcaaagctctgtggagag
cttagacctcacgcacttgcactcgtggcttcattcgggattccagacgccttcttgagt
ccaattgcattcaactgggtcgaagccaacgcttggtcttcactttag

KEGG   Arabidopsis thaliana (thale cress): AT2G35690
Entry
AT2G35690         CDS       T00041                                 
Symbol
ACX5
Name
(RefSeq) acyl-CoA oxidase 5
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00410  beta-Alanine metabolism
ath00592  alpha-Linolenic acid metabolism
ath00640  Propanoate metabolism
ath01040  Biosynthesis of unsaturated fatty acids
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AT2G35690 (ACX5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT2G35690 (ACX5)
   00592 alpha-Linolenic acid metabolism
    AT2G35690 (ACX5)
   01040 Biosynthesis of unsaturated fatty acids
    AT2G35690 (ACX5)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT2G35690 (ACX5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT2G35690 (ACX5)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     AT2G35690 (ACX5)
SSDB
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Other DBs
NCBI-GeneID: 818138
NCBI-ProteinID: NP_181112
TAIR: AT2G35690
UniProt: Q9ZQP2
LinkDB
Position
2:14999726..15003073
AA seq 664 aa
MERVDHLADERNKAEFNVDDMKIVWAGSRHAFDVSNRMSRLVANDPVFEKSKRAVMSRKE
LFKNTLRKSVHAWKLINELRLSDEEGLKLRSFMDQPGFLDLHWGMFVPAIKGQGTEQQQQ
KWLSLATKMQIIGCYAQTELGHGSNVQGLETTATFDPKTDQFIIHSPTQTSSKWWPGGLG
KVSTHAVIYARLITNGKDHGVHGFIVQLRSLDDHSPLPGITVGDIGMKFGNGAYNSMDNG
FLMFDHFRIPRDQMLMRLSKVTREGKYVASDVPRQLVYGTMVYVRQSIVSNASTALARAV
CIATRYSAVRRQFGSHDGGIETQVINYKTQQNRLFPLLASAYAFRFVGEWLKWLYTDVTK
RLEASDFATLPEAHACTAGLKSMTTSATSDGIEECRKLCGGHGYLWCSGLPELFAVYVPA
CTYEGDNVVLQLQVARFLMKTVSQLGSGKAPSGTTAYMGRAKHLLQCSSGVRNARDWLNP
GMVLEAFEARALRMAVTCANNLSKFENQEQGFSELLADLVEAATAHCQLIVVSKFIAKVE
GDIEGKGVKKQLKNLCYIYALYLLHKHLGDFLSTNSVTPEQASLANQQLRSLYSQVRPNA
VALVDAFDYTDQYLGSVLGRYDGNVYPKLFEEALKDPLNDSVVPDGYREYIRPLIKQRFR
SAKL
NT seq 1995 nt   +upstreamnt  +downstreamnt
atggagagagttgatcaccttgccgatgagaggaacaaagcagagttcaacgtcgacgat
atgaagatcgtctgggccggttcccgccacgctttcgatgtttcaaatcgtatgtctcgc
ctcgtcgctaatgatccggtctttgagaaaagcaaaagagctgtgatgagtaggaaagag
ttgttcaagaacacgttgaggaaaagtgttcacgcttggaagttgattaacgagcttcgt
ctctcagatgaggaaggactcaaattgagatctttcatggatcaaccaggcttcttggat
ctgcattggggaatgtttgtgcctgcaattaaaggacaaggcacagagcaacaacaacaa
aagtggttgtctttagctactaagatgcagataattggatgttatgctcaaactgagctt
ggtcatggctctaatgttcaaggccttgagacaaccgctacttttgatccaaagacagat
cagtttatcattcacagtccaactcagacatcatccaaatggtggcctggtgggttagga
aaagtttctactcatgctgttatttatgctcgtctaataaccaatggcaaagaccatggt
gtacatggattcatcgtgcagctgcgtagtttggatgatcattctcctcttccgggtata
accgttggtgatatcggaatgaagtttggaaacggggcatataactcaatggacaatggt
tttcttatgtttgatcattttcgcattcctagagatcaaatgctcatgagactgtcaaaa
gttacaagagaaggaaaatatgtagcatcagatgttccaaggcaattggtgtatggtact
atggtgtatgtgagacagtctattgtgtcaaatgcttccaccgcgctggctcgggcagtt
tgcattgctactaggtacagtgctgttcgaaggcagtttggctcacatgatggtggcatt
gagacacaggtgattaattataaaactcagcagaacaggttgtttcctctgctggcatct
gcatatgcatttcggtttgtaggggaatggctgaagtggctctacactgatgtaacaaaa
agactagaggccagtgatttcgcaacattgcctgaagctcatgcatgcactgctggattg
aagtctatgactacctcagccacctctgatgggattgaagaatgtcgtaagttatgtggt
ggacatggatacttgtggtgtagtgggcttcctgaattgtttgctgtatatgttcctgct
tgcacatacgagggagacaatgttgtgttgcagttacaggttgctagatttctgatgaag
acagtttcacagttgggttctggaaaggctccttctgggacaactgcttatatgggcaga
gcaaaacaccttttgcaatgcagttccggagttcgaaatgctagggactggttaaaccct
ggtatggtgttggaagcttttgaagcaagagctttgagaatggctgttacttgtgctaac
aatctaagcaagtttgagaatcaagaacaaggattctcagaactcttggctgatcttgtt
gaggctgctactgctcattgccagttaattgttgtttctaagtttatagccaaagtagag
ggagatattgaaggaaaaggagtgaagaaacagctcaagaatctatgctacatctacgca
ctctatctccttcacaaacaccttggtgatttcctcagtacaaactctgttactcctgaa
caagcctcacttgcgaaccagcagcttcgatcactctactctcaggttcgaccaaacgca
gtggccctagtggacgccttcgactacacggaccagtatcttggctctgtcttaggccgc
tatgacggaaacgtttatccaaagcttttcgaggaagcgttgaaggatccactcaatgac
tcggtggttcctgacggctaccgtgagtacatccgaccgttgattaagcaacgcttccgc
tctgccaaactctaa

KEGG   Arabidopsis thaliana (thale cress): AT3G06690
Entry
AT3G06690         CDS       T00041                                 
Name
(RefSeq) putative acyl-coenzyme A oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00410  beta-Alanine metabolism
ath00592  alpha-Linolenic acid metabolism
ath00640  Propanoate metabolism
ath01040  Biosynthesis of unsaturated fatty acids
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AT3G06690
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT3G06690
   00592 alpha-Linolenic acid metabolism
    AT3G06690
   01040 Biosynthesis of unsaturated fatty acids
    AT3G06690
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT3G06690
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G06690
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     AT3G06690
SSDB
Motif
Pfam: ACOX
Other DBs
NCBI-GeneID: 819854
NCBI-ProteinID: NP_187325
TAIR: AT3G06690
UniProt: P0CZ24
LinkDB
Position
3:complement(2115426..2116825)
AA seq 187 aa
MTKEPIYSPRMLHRDPDSPRPVLPTQLTSSTLRCSQFQTNVFCLRERDLLERFTSEVAQL
QGRGESREFSFLLSHQLAEDLGKAFTEKAMLQTILDAEAKLPTGSVKDVLGLVRSMYALI
SLEEDPSLLRYGYLSQDNVGDVRREVSKLCGELRPHALALVTSFGIPDSFLSPIAFNWVE
ANTWSSV
NT seq 564 nt   +upstreamnt  +downstreamnt
atgactaaagaacccatttactctccccgaatgttacacagagatcctgatagtccacgt
cctgtattaccgactcaactcacatcatcaaccctcagatgcagccaattccagacaaat
gtgttctgcttaagagagcgagatcttctagagcgatttacttctgaagttgcacagctt
caagggagaggagaaagtcgagaattctctttcctcctgagtcatcaacttgctgaagac
ttaggtaaagctttcacagagaaagcaatgcttcaaaccattttggatgctgaggcaaaa
ctacctactggctcagtaaaggatgtgttgggtcttgtaagatcaatgtacgcattgatc
agcctggaagaagatccatcgttgctgcgatatggttacctatctcaggataatgttgga
gatgtgaggagagaagtttcaaagctctgtggagagcttagaccacacgcgcttgcactc
gtcacttcattcggcattccagactccttcttgagtccaattgcattcaactgggtcgaa
gccaatacttggtcttcagtttag

KEGG   Arabidopsis thaliana (thale cress): AT3G51840
Entry
AT3G51840         CDS       T00041                                 
Symbol
ACX4
Name
(RefSeq) acyl-CoA oxidase 4
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00410  beta-Alanine metabolism
ath00592  alpha-Linolenic acid metabolism
ath00640  Propanoate metabolism
ath01040  Biosynthesis of unsaturated fatty acids
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AT3G51840 (ACX4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT3G51840 (ACX4)
   00592 alpha-Linolenic acid metabolism
    AT3G51840 (ACX4)
   01040 Biosynthesis of unsaturated fatty acids
    AT3G51840 (ACX4)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT3G51840 (ACX4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G51840 (ACX4)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     AT3G51840 (ACX4)
SSDB
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2
Other DBs
NCBI-GeneID: 824347
NCBI-ProteinID: NP_190752
TAIR: AT3G51840
UniProt: Q96329 A0A654FFV7
Structure
LinkDB
Position
3:complement(19225360..19229341)
AA seq 436 aa
MAVLSSADRASNEKKVKSSYFDLPPMEMSVAFPQATPASTFPPCTSDYYHFNDLLTPEEQ
AIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSIKGYGCPGLSITANAI
ATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQLNTVACWALTEPDNG
SDASGLGTTATKVEGGWKINGQKRWIGNSTFADLLIIFARNTTTNQINGFIVKKDAPGLK
ATKIPNKIGLRMVQNGDILLQNVFVPDEDRLPGVNSFQDTSKVLAVSRVMVAWQPIGISM
GIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAMFLMGWRLCKLYETGQMTPGQ
ASLGKAWISSKARETASLGRELLGGNGILADFLVAKAFCDLEPIYTYEGTYDINTLVTGR
EVTGIASFKPATRSRL
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggcggtgctttcatctgcagatcgagctagtaatgagaagaaggtgaagagttcatac
tttgatttgccacctatggaaatgtctgtagcatttcctcaagcaactccagcctctaca
tttccaccttgtacttcagactattatcatttcaatgatctactgactccggaagaacaa
gctatccggaagaaagtgagggaatgcatggagaaagaagttgctccaataatgacagag
tactgggagaaagcagaatttccattccatatcactccaaagcttggggctatgggtgtt
gctggtggctcgatcaagggttatggatgtcctggtctctccatcaccgccaatgcaatt
gccacagcagaaatagctagagttgatgcaagttgttcgactttcattttggtgcattct
tctttgggcatgctcactattgcactctgtggatcagaagcacagaaggagaagtatttg
ccttctttggctcaattgaatactgtggcttgttgggctttgacagagcccgacaatgga
agcgatgcaagtggtctaggaacgactgcaacaaaggttgaaggaggttggaaaattaat
ggacaaaagcgttggattggaaacagcacctttgcagatctgttgatcatctttgcgagg
aatacaacaactaaccaaatcaacggattcatagtcaagaaagatgcgcctggcctaaag
gctactaagatcccaaataaaataggtttacgtatggttcaaaatggagatattctacta
cagaatgtctttgttccagatgaggatcggttacctggggtaaattcttttcaggacacc
agcaaggttctggctgtctcacgtgtaatggtggcctggcaaccaatcggcatatcaatg
ggaatctacgatatgtgccacaggtatctgaaggagaggaaacagtttggagcaccgttg
gctgctttccagttaaaccaacagaagcttgtgcagatgctgggtaacgttcaagcgatg
tttctaatgggttggcgtctctgcaagctgtatgagacgggtcagatgactccaggtcaa
gccagtttaggaaaggcatggatttcatcaaaagcgagagaaactgcttcgctaggtcgg
gaattacttggtgggaatggaattctagcagattttctggtagcaaaggctttctgtgac
cttgaacccatttatacatacgaagggacttatgatataaacaccttagtaacagggagg
gaagtaacgggtattgcgagtttcaaaccggctacacgtagccgtctctaa

KEGG   Arabidopsis thaliana (thale cress): AT4G16760
Entry
AT4G16760         CDS       T00041                                 
Symbol
ACX1
Name
(RefSeq) acyl-CoA oxidase 1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00410  beta-Alanine metabolism
ath00592  alpha-Linolenic acid metabolism
ath00640  Propanoate metabolism
ath01040  Biosynthesis of unsaturated fatty acids
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AT4G16760 (ACX1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT4G16760 (ACX1)
   00592 alpha-Linolenic acid metabolism
    AT4G16760 (ACX1)
   01040 Biosynthesis of unsaturated fatty acids
    AT4G16760 (ACX1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT4G16760 (ACX1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT4G16760 (ACX1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     AT4G16760 (ACX1)
SSDB
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Other DBs
NCBI-GeneID: 827381
NCBI-ProteinID: NP_567513
TAIR: AT4G16760
UniProt: O65202
Structure
LinkDB
Position
4:complement(9424534..9428895)
AA seq 664 aa
MEGIDHLADERNKAEFDVEDMKIVWAGSRHAFEVSDRIARLVASDPVFEKSNRARLSRKE
LFKSTLRKCAHAFKRIIELRLNEEEAGRLRHFIDQPAYVDLHWGMFVPAIKGQGTEEQQK
KWLSLANKMQIIGCYAQTELGHGSNVQGLETTATFDPKTDEFVIHTPTQTASKWWPGGLG
KVSTHAVVYARLITNGKDYGIHGFIVQLRSLEDHSPLPNITVGDIGTKMGNGAYNSMDNG
FLMFDHVRIPRDQMLMRLSKVTREGEYVPSDVPKQLVYGTMVYVRQTIVADASNALSRAV
CIATRYSAVRRQFGAHNGGIETQVIDYKTQQNRLFPLLASAYAFRFVGEWLKWLYTDVTE
RLAASDFATLPEAHACTAGLKSLTTTATADGIEECRKLCGGHGYLWCSGLPELFAVYVPA
CTYEGDNVVLQLQVARFLMKTVAQLGSGKVPVGTTAYMGRAAHLLQCRSGVQKAEDWLNP
DVVLEAFEARALRMAVTCAKNLSKFENQEQGFQELLADLVEAAIAHCQLIVVSKFIAKLE
QDIGGKGVKKQLNNLCYIYALYLLHKHLGDFLSTNCITPKQASLANDQLRSLYTQVRPNA
VALVDAFNYTDHYLNSVLGRYDGNVYPKLFEEALKDPLNDSVVPDGYQEYLRPVLQQQLR
TARL
NT seq 1995 nt   +upstreamnt  +downstreamnt
atggaaggaattgatcacctcgccgatgagagaaacaaagcagagttcgacgttgaggat
atgaagatcgtctgggctggttcccgccacgcttttgaggtttccgatcgaattgcccgc
cttgtcgccagcgatccggtatttgagaaaagcaatcgagctcggttgagtaggaaggag
ctgtttaagagtacgttgagaaaatgtgcccatgcgtttaaaaggattatcgagcttcgt
ctcaatgaggaagaagcaggaagattgaggcactttatcgaccagcctgcctatgtggat
ctgcactggggaatgtttgtgcctgctattaaggggcagggtacagaggagcagcagaag
aagtggttgtcgctggccaataagatgcagattattgggtgttatgcacagactgagctt
ggtcatggctcaaatgttcaaggacttgagacaactgccacatttgatcccaagactgat
gagtttgtaattcacactccaactcagactgcatccaaatggtggcctggtggtttggga
aaagtttctactcatgctgttgtttacgctcgtctcataactaacggaaaagactacggt
atccatggattcatcgtgcaactgcgaagcttagaagatcattctcctcttccgaatata
actgttggtgatatcgggacaaagatgggaaatggagcatataattcaatggacaacggg
tttcttatgtttgatcatgttcgcattcctagagatcaaatgctcatgaggctgtcaaaa
gttacaagagaaggagaatatgttccatcggatgttccaaagcagctggtatatggtact
atggtgtatgtgagacaaacaattgtggctgatgcttccaatgcactatctcgagcagtt
tgcatagctacaagatacagtgcagtgcggaggcaatttggcgcacataatggtggcatt
gagacacaggtgattgattataaaactcagcagaacaggctatttcctctgctagcatct
gcatatgcatttcgatttgttggagagtggctaaaatggctgtacacggatgtaactgaa
agactggcggctagtgatttcgcaactttgcctgaggctcatgcatgcactgcaggattg
aagtctctcaccaccacagccactgcggatggcattgaagaatgtcgtaagttatgtggt
ggacatggatacttgtggtgcagtgggctccccgagctgtttgctgtatatgttcctgcc
tgcacatacgaaggagacaatgttgtgctgcaattacaggttgctcgattcctcatgaag
acagtcgcccagctgggatctggaaaggttcctgttggcacaactgcttatatgggccgg
gcagcacatcttttgcaatgtcgttctggtgttcaaaaggctgaggattggttaaaccct
gatgttgtactggaagctttcgaagctagggctctcagaatggctgttacgtgtgccaaa
aatctcagcaagtttgagaatcaggaacaaggattccaagagctcttggctgatttggtt
gaggccgctattgctcattgccaattgattgttgtttccaagttcatagcgaaactggag
caagacataggtggcaaaggagtgaagaaacagctgaataatctgtgttacatttatgct
ctttatctcctccacaaacatctcggcgatttcctctccactaactgcatcactcccaaa
caagcctctcttgctaacgaccagctccgttccttatacactcaggtccggcctaatgcg
gttgcacttgtggacgccttcaattacaccgaccattacttgaactcggttcttggccgt
tacgacggtaatgtgtacccaaagctctttgaggaagcgttgaaggatccattgaacgac
tcggtggttcctgatgggtaccaagaataccttcgacctgtgcttcagcagcaacttcgt
accgctaggctctga

KEGG   Arabidopsis thaliana (thale cress): AT5G65110
Entry
AT5G65110         CDS       T00041                                 
Symbol
ACX2
Name
(RefSeq) acyl-CoA oxidase 2
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00410  beta-Alanine metabolism
ath00592  alpha-Linolenic acid metabolism
ath00640  Propanoate metabolism
ath01040  Biosynthesis of unsaturated fatty acids
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AT5G65110 (ACX2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT5G65110 (ACX2)
   00592 alpha-Linolenic acid metabolism
    AT5G65110 (ACX2)
   01040 Biosynthesis of unsaturated fatty acids
    AT5G65110 (ACX2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT5G65110 (ACX2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT5G65110 (ACX2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     AT5G65110 (ACX2)
SSDB
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Other DBs
NCBI-GeneID: 836635
NCBI-ProteinID: NP_201316
TAIR: AT5G65110
UniProt: O65201 A0A178UA38
LinkDB
Position
5:complement(26009521..26012684)
AA seq 692 aa
MESRREKNPMTEEESDGLIAARRIQRLSLHLSPSLTPSPSLPLVQTETCSARSKKLDVNG
EALSLYMRGKHIDIQEKIFDFFNSRPDLQTPIEISKDDHRELCMNQLIGLVREAGVRPFR
YVADDPEKYFAIMEAVGSVDMSLGIKMGVQYSLWGGSVINLGTKKHRDKYFDGIDNLDYT
GCFAMTELHHGSNVQGLQTTATFDPLKDEFVIDTPNDGAIKWWIGNAAVHGKFATVFARL
ILPTHDSKGVSDMGVHAFIVPIRDMKTHQTLPGVEIQDCGHKVGLNGVDNGALRFRSVRI
PRDNLLNRFGDVSRDGTYTSSLPTINKRFGATLGELVGGRVGLAYASVGVLKISATIAIR
YSLLRQQFGPPKQPEVSILDYQSQQHKLMPMLASTYAYHFATVYLVEKYSEMKKTHDEQL
VADVHALSAGLKSYVTSYTAKALSVCREACGGHGYAAVNRFGSLRNDHDIFQTFEGDNTV
LLQQVAADLLKRYKEKFQGGTLTVTWSYLRESMNTYLSQPNPVTARWEGEDHLRDPKFQL
DAFRYRTSRLLQNVAARLQKHSKTLGGFGAWNRCLNHLLTLAESHIETVILAKFIEAVKN
CPDPSAKAALKLACDLYALDRIWKDIGTYRNVDYVAPNKAKAIHKLTEYLSFQVRNVAKE
LVDAFELPDHVTRAPIAMQSDAYSQYTQVVGF
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggaatcgcggcgagagaagaatccgatgacggaggaggaatctgatgggctaattgcg
gcgaggcggatccaacgattgtctttacacctatctccctccttgacgccgtcgccgtcg
ttaccgttggtgcagacggagacgtgttcggcgaggtcgaagaagctggatgtcaacggc
gaagctttgtcgctgtatatgagaggaaaacatatagatatacaagagaaaattttcgac
tttttcaattcccgacccgatttgcagacgccgatcgagatctccaaggatgatcatcgg
gaattgtgtatgaatcagcttatagggcttgttagagaagctggggtaaggccgtttagg
tatgttgctgatgatcctgagaagtatttcgcaatcatggaagctgttggaagtgttgat
atgtcccttgggattaagatgggcgttcaatacagtctctggggaggctctgtgatcaat
ttagggactaagaagcatagagacaagtattttgatggcattgacaatcttgattacacc
ggttgctttgccatgactgaattacaccatgggtcaaatgtgcaaggtcttcagaccacg
gcgacattcgatccacttaaagacgaatttgtgatcgatacacctaatgatggagctatc
aaatggtggattggaaatgctgcagttcatgggaagtttgccactgtttttgccaggctt
atacttccaactcatgattccaaaggagtctcggatatgggtgttcacgccttcattgtt
ccgataagggatatgaaaacacaccagacactccctggtgttgaaatccaagattgtgga
cataaagtgggacttaatggagtggataatggtgcgttgagattccgttctgtgagaata
ccccgtgataatcttctcaatcgttttggagatgtgtcccgagatgggacgtatacaagt
agtttgccaacaatcaataaaagatttggtgcaacactcggtgagcttgtaggtggtcga
gttggccttgcctatgcatctgttggcgtccttaaaatctctgcaacgattgccattcgt
tattctcttctaagacaacaattcgggcctccaaagcaacctgaggtcagtattctcgat
taccagtctcaacaacacaagctcatgccgatgttagcctccacctatgcataccatttt
gcaactgtataccttgtggagaaatattcagagatgaagaagactcacgatgagcaattg
gttgctgatgtccatgcactctctgctgggctcaaatcttatgtgacgtcttacaccgcc
aaggcgctctcggtctgcagagaagcctgtggaggtcatggttacgcagctgttaaccga
tttggaagcttgagaaatgatcatgacattttccaaacatttgaaggagacaacactgta
cttctgcaacaggtggctgctgatttattgaagcgttataaagaaaagttccaaggcggg
acattgacagttacatggagctacttgagagaatcaatgaacacttatttgtctcagcca
aatcccgttacagcgcgttgggaaggtgaagatcatctaagagatcctaaattccaacta
gatgctttccggtatcgaacatcgcgattgctacaaaatgtggcagcgagattgcagaag
cattcaaagactcttggtggtttcggggcatggaacagatgcttgaatcatcttttaacg
cttgcagaatctcacattgaaacagtcattcttgccaagttcatcgaagctgttaaaaac
tgcccggacccaagtgcaaaagctgctctgaaactagcatgtgatctttacgcattggac
cgaatctggaaagatataggaacgtaccgtaacgtggattatgtggcgcctaacaaagct
aaggcgattcataaactgacagagtatttgagttttcaagtaaggaatgtggccaaggaa
ctagtggatgcgttcgagctccctgatcatgttactcgagcaccaattgctatgcagtcc
gatgcttattcccagtatactcaagttgttggattctaa

DBGET integrated database retrieval system