KEGG   Arabidopsis thaliana (thale cress): AT1G08830
Entry
AT1G08830         CDS       T00041                                 
Symbol
CSD1
Name
(RefSeq) copper/zinc superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT1G08830 (CSD1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AT1G08830 (CSD1)
SSDB
Motif
Pfam: Sod_Cu aRib
Other DBs
NCBI-GeneID: 837405
NCBI-ProteinID: NP_001077494
TAIR: AT1G08830
UniProt: P24704 A0A178WMU1
LinkDB
Position
1:2827060..2829315
AA seq 152 aa
MAKGVAVLNSSEGVTGTIFFTQEGDGVTTVSGTVSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPDGKTHGAPEDANRHAGDLGNITVGDDGTATFTITDCQIPLTGPNSIVGRAVVVHA
DPDDLGKGGHELSLATGNAGGRVACGIIGLQG
NT seq 459 nt   +upstreamnt  +downstreamnt
atggcgaaaggagttgcagttttgaacagcagtgagggtgttacggggactatctttttc
acccaggaaggcgatggtgtgaccactgtgagtggaacagtttctggccttaagcctggt
cttcatggtttccatgtccatgctcttggtgacaccactaacggttgcatgtctactggt
ccacatttcaaccccgatggtaaaacacacggtgcccctgaggatgctaatcgacatgct
ggtgatctaggaaacatcactgttggagatgatggaactgccaccttcacaatcactgat
tgccagattcctcttactggaccaaactctattgttggtagggctgttgttgtccatgca
gaccctgatgacctcggaaagggaggccatgaactcagcctggctactggaaacgcaggc
ggccgtgttgcttgcggcatcattggtctccagggctaa

KEGG   Arabidopsis thaliana (thale cress): AT2G28190
Entry
AT2G28190         CDS       T00041                                 
Symbol
CSD2
Name
(RefSeq) copper/zinc superoxide dismutase 2
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT2G28190 (CSD2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AT2G28190 (CSD2)
SSDB
Motif
Pfam: Sod_Cu
Other DBs
NCBI-GeneID: 817365
NCBI-ProteinID: NP_565666
TAIR: AT2G28190
UniProt: O78310 A0A178VRV1
LinkDB
Position
2:12014412..12016569
AA seq 216 aa
MAATNTILAFSSPSRLLIPPSSNPSTLRSSFRGVSLNNNNLHRLQSVSFAVKAPSKALTV
VSAAKKAVAVLKGTSDVEGVVTLTQDDSGPTTVNVRITGLTPGPHGFHLHEFGDTTNGCI
STGPHFNPNNMTHGAPEDECRHAGDLGNINANADGVAETTIVDNQIPLTGPNSVVGRAFV
VHELKDDLGKGGHELSLTTGNAGGRLACGVIGLTPL
NT seq 651 nt   +upstreamnt  +downstreamnt
atggctgccaccaacacaatcctcgcattctcatctccttctcgtcttctcattcctcct
tcctccaatccttcaactctccgttcctctttccgcggcgtctctctcaacaacaacaat
ctccaccgtctccaatctgtttccttcgccgttaaagctccgtcgaaagcgttgacagtt
gtttccgcggcgaagaaggctgttgcagtgcttaaaggtacttctgatgtcgaaggagtt
gttactttgacccaagatgactcaggtcctacaactgtgaatgttcgtatcactggtctc
actccagggcctcatggatttcatctccatgagtttggtgatacaactaatggatgtatc
tcaacaggaccacatttcaaccctaacaacatgacacacggagctccagaagatgagtgc
cgtcatgcgggtgacctgggaaacataaatgccaatgccgatggcgtggcagaaacaaca
atagtggacaatcagattcctctgactggtcctaattctgttgttggaagagcctttgtg
gttcacgagcttaaggatgacctcggaaagggtggccatgagcttagtctgaccactgga
aacgcaggcgggagattggcatgtggtgtgattggcttgacgccgctctaa

KEGG   Arabidopsis thaliana (thale cress): AT3G10920
Entry
AT3G10920         CDS       T00041                                 
Symbol
MSD1
Name
(RefSeq) manganese superoxide dismutase 1
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G10920 (MSD1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AT3G10920 (MSD1)
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N PSII_Pbs31
Other DBs
NCBI-GeneID: 820263
NCBI-ProteinID: NP_187703
TAIR: AT3G10920
UniProt: O81235
Structure
LinkDB
Position
3:3417940..3419892
AA seq 231 aa
MAIRCVASRKTLAGLKETSSRLLRIRGIQTFTLPDLPYDYGALEPAISGEIMQIHHQKHH
QAYVTNYNNALEQLDQAVNKGDASTVVKLQSAIKFNGGGHVNHSIFWKNLAPSSEGGGEP
PKGSLGSAIDAHFGSLEGLVKKMSAEGAAVQGSGWVWLGLDKELKKLVVDTTANQDPLVT
KGGSLVPLVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEKENN
NT seq 696 nt   +upstreamnt  +downstreamnt
atggcgattcgttgtgtagcgagtagaaaaaccctagccggcttgaaggagacatcatcg
aggctattgaggatcagagggattcagacttttacgcttcctgatcttccttacgattat
ggcgcattggaaccggccattagtggagagatcatgcagattcatcaccagaagcatcac
caggcttatgttactaattacaataatgctcttgagcagcttgatcaagctgtgaacaag
ggagatgcttccactgttgttaagttgcagagcgccatcaaattcaacggcggaggtcat
gtcaaccattcgattttctggaagaaccttgctccttccagtgaaggtggtggagagcca
ccaaaaggatctcttggtagtgccattgacgctcactttggctcccttgaaggtctggtg
aaaaagatgagtgctgagggtgctgcagtgcaaggctcaggatgggtgtggctcggacta
gacaaagaactgaagaagctagttgttgacacaactgccaatcaggatccattagtgaca
aaaggaggaagcttggtacctctggtgggtatagatgtttgggagcacgcctactacttg
cagtacaaaaatgtgaggcctgagtatctgaagaatgtatggaaagtgatcaactggaaa
tatgcaagcgaggtttatgagaaggaaaacaactga

KEGG   Arabidopsis thaliana (thale cress): AT3G56350
Entry
AT3G56350         CDS       T00041                                 
Name
(RefSeq) Iron/manganese superoxide dismutase family protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G56350
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AT3G56350
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-GeneID: 824802
NCBI-ProteinID: NP_191194
TAIR: AT3G56350
UniProt: Q9LYK8 A0A178VDJ0
LinkDB
Position
3:complement(20893946..20895634)
AA seq 241 aa
MTTTVIIIIFVAIFATTLHDARGATMEPCLESMKTASLPDLPYAYDALEPAISEEIMRLH
HQKHHQTYVTQYNKALNSLRSAMADGDHSSVVKLQSLIKFNGGGHVNHAIFWKNLAPVHE
GGGKPPHDPLASAIDAHFGSLEGLIQKMNAEGAAVQGSGWVWFGLDRELKRLVVETTANQ
DPLVTKGSHLVPLIGIDVWEHAYYPQYKNARAEYLKNIWTVINWKYAADVFEKHTRDLDI
N
NT seq 726 nt   +upstreamnt  +downstreamnt
atgacgaccaccgttattatcattatcttcgttgccatcttcgctacgactcttcacgac
gccagaggagcaaccatggaaccgtgtctcgaatcaatgaagactgcttcgcttcctgat
cttccgtatgcttatgatgcgctagagccagcaatcagtgaggagatcatgcggctacac
catcagaaacaccaccagacttatgtcactcagtacaacaaagccctcaacagccttcgt
tctgccatggctgacggtgatcactcctccgtcgtcaaactccaaagcctcatcaagttc
aacggcggagggcacgttaaccatgcaatcttctggaaaaacctagccccggttcatgaa
ggaggtggcaaaccaccgcatgatcctttggcttcggcgatcgatgctcatttcggatca
ctagaaggattgatccaaaaaatgaacgcggaaggcgctgctgtacagggatctggatgg
gtgtggtttggattagacagagagcttaagagacttgtcgttgaaaccacagccaaccag
gatccattggtgactaagggatcacacctagttcctctaattgggattgacgtgtgggag
catgcctactatccacagtacaagaatgcaagagcggagtacttgaagaacatatggact
gtaatcaactggaaatatgcagcggacgtcttcgagaagcacactcgtgatcttgatatt
aactga

KEGG   Arabidopsis thaliana (thale cress): AT4G25100
Entry
AT4G25100         CDS       T00041                                 
Symbol
FSD1
Name
(RefSeq) Fe superoxide dismutase 1
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT4G25100 (FSD1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AT4G25100 (FSD1)
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-GeneID: 828613
NCBI-ProteinID: NP_194240
TAIR: AT4G25100
UniProt: P21276 A0A654FSM5
LinkDB
Position
4:complement(12884300..12887011)
AA seq 212 aa
MAASSAVTANYVLKPPPFALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKP
LEHIIHSTYNNGDLLPAFNNAAQAWNHEFFWESMKPGGGGKPSGELLALLERDFTSYEKF
YEEFNAAAATQFGAGWAWLAYSNEKLKVVKTPNAVNPLVLGSFPLLTIDVWEHAYYLDFQ
NRRPDYIKTFMTNLVSWEAVSARLEAAKAASA
NT seq 639 nt   +upstreamnt  +downstreamnt
atggctgcttcaagtgctgtcaccgcaaactacgtcctcaagccacctccattcgcactg
gatgctttggagccgcatatgagcaaacaaactctggagtttcactggggaaaacatcac
agagcttacgtggacaacctcaagaaacaggttcttggaaccgagcttgaaggcaagccc
ttagagcacattatccacagcacttacaacaatggtgatctcctccctgctttcaacaac
gctgctcaggcgtggaaccacgagttcttctgggagtcaatgaaaccaggtggtggagga
aaaccatcaggagagcttcttgctttgcttgaaagagatttcacttcttatgagaagttc
tatgaagagttcaatgctgctgcagccactcagtttggagctggctgggcctggcttgct
tattcaaatgaaaaactcaaagtagtgaaaactcccaatgctgtgaatccccttgtgctc
ggctctttcccattgcttaccattgatgtctgggagcatgcttactaccttgacttccag
aaccgaagaccagattacataaagacattcatgaccaatcttgtgtcttgggaagctgta
agtgccagacttgaggccgccaaggctgcttctgcttaa

KEGG   Arabidopsis thaliana (thale cress): AT5G18100
Entry
AT5G18100         CDS       T00041                                 
Symbol
CSD3
Name
(RefSeq) copper/zinc superoxide dismutase 3
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT5G18100 (CSD3)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AT5G18100 (CSD3)
SSDB
Motif
Pfam: Sod_Cu
Other DBs
NCBI-GeneID: 831928
NCBI-ProteinID: NP_197311
TAIR: AT5G18100
UniProt: Q9FK60 A0A5S9Y7F6
LinkDB
Position
5:5987187..5988885
AA seq 164 aa
MEAPRGNLRAVALIAGDNNVRGCLQFVQDISGTTHVTGKISGLSPGFHGFHIHSFGDTTN
GCISTGPHFNPLNRVHGPPNEEERHAGDLGNILAGSNGVAEILIKDKHIPLSGQYSILGR
AVVVHADPDDLGKGGHKLSKSTGNAGSRVGCGIIGLQSSADAKL
NT seq 495 nt   +upstreamnt  +downstreamnt
atggaagctcctagaggaaatctgagagcggtggctcttatcgccggcgataacaacgtc
cgaggctgtcttcaattcgtacaagacatttccggaactactcatgtcaccgggaagatc
tcaggactctctcctggcttccatggatttcatattcactcttttggtgataccacaaat
ggctgcatctctactggacctcacttcaatccattaaatcgagttcacgggccaccgaac
gaggaagagcgtcatgctggcgatttgggtaacattcttgcaggatcaaacggtgttgct
gaaatcttaatcaaagacaaacatataccgcttagtgggcagtattccatactcgggagg
gcggttgttgtgcatgcggatcctgatgaccttgggaaaggagggcacaagcttagcaaa
tcaactggaaacgcaggctcgagagttggatgtggtatcatcggacttcaatcatctgcg
gatgctaaactatag

KEGG   Arabidopsis thaliana (thale cress): AT5G23310
Entry
AT5G23310         CDS       T00041                                 
Symbol
FSD3
Name
(RefSeq) Fe superoxide dismutase 3
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT5G23310 (FSD3)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AT5G23310 (FSD3)
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF5617
Other DBs
NCBI-GeneID: 832395
NCBI-ProteinID: NP_197722
TAIR: AT5G23310
UniProt: Q9FMX0 A0A178UFT0
LinkDB
Position
5:7850444..7852534
AA seq 263 aa
MSSCVVTTSCFYTISDSSIRLKSPKLLNLSNQQRRRSLRSRGGLKVEAYYGLKTPPYPLD
ALEPYMSRRTLEVHWGKHHRGYVDNLNKQLGKDDRLYGYTMEELIKATYNNGNPLPEFNN
AAQVYNHDFFWESMQPGGGDTPQKGVLEQIDKDFGSFTNFREKFTNAALTQFGSGWVWLV
LKREERRLEVVKTSNAINPLVWDDIPIICVDVWEHSYYLDYKNDRAKYINTFLNHLVSWN
AAMSRMARAEAFVNLGEPNIPIA
NT seq 792 nt   +upstreamnt  +downstreamnt
atgagttcttgtgttgtgacgacaagctgtttctatacaatttcagattctagtatacgt
ttgaaatcccccaagctcctcaatctgagtaaccagcagagaagacgctctcttaggtct
cgaggtggtttaaaggttgaagcttactacggtctaaagacacctccttatccacttgat
gctttggagccgtatatgagtagaagaacactagaagtgcattggggaaaacaccatcga
ggttatgtagataatctgaataaacagttagggaaagatgatagactctatggatacacc
atggaagagcttatcaaggctacatacaacaacgggaatcctttacccgagttcaacaac
gctgcacaggtctataaccatgatttcttctgggagtcgatgcaacctggtggtggagac
acgcctcaaaagggtgttcttgagcagattgataaggattttggttctttcacaaatttt
agagaaaagttcactaatgcagctcttactcagtttggttctggatgggtctggcttgtc
ttaaagagggaagagagaaggcttgaggtggtcaaaacctcaaacgccattaacccactc
gtgtgggacgatattccaatcatctgcgtggatgtgtgggagcactcttattatctggac
tacaagaacgacagggctaagtatataaacacatttctgaaccacttggtgtcgtggaac
gctgccatgagtcggatggcccgtgcagaagcgtttgtgaatcttggtgaacccaacatc
ccaatcgcttaa

KEGG   Arabidopsis thaliana (thale cress): AT5G51100
Entry
AT5G51100         CDS       T00041                                 
Symbol
FSD2
Name
(RefSeq) Fe superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT5G51100 (FSD2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AT5G51100 (FSD2)
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-GeneID: 835183
NCBI-ProteinID: NP_199923
TAIR: AT5G51100
UniProt: Q9LU64
Structure
LinkDB
Position
5:complement(20773235..20775739)
AA seq 305 aa
MMNVAVTATPSSLLYSPLLLPSQGPNRRMQWKRNGKRRLGTKVAVSGVITAGFELKPPPY
PLDALEPHMSRETLDYHWGKHHKTYVENLNKQILGTDLDALSLEEVVLLSYNKGNMLPAF
NNAAQAWNHEFFWESIQPGGGGKPTGELLRLIERDFGSFEEFLERFKSAAASNFGSGWTW
LAYKANRLDVANAVNPLPKEEDKKLVIVKTPNAVNPLVWDYSPLLTIDTWEHAYYLDFEN
RRAEYINTFMEKLVSWETVSTRLESAIARAVQREQEGTETEDEENPDDEVPEVYLDSDID
VSEVD
NT seq 918 nt   +upstreamnt  +downstreamnt
atgatgaatgttgcagtgacagccactccctcgtctctcttgtactctcctctgcttctt
ccttctcaagggccaaaccggcgaatgcaatggaaaagaaacggaaagagacggttaggg
acaaaggtggctgtttccggtgttatcacagctggatttgagctgaagccacctccatat
cctcttgatgctctggaaccgcatatgagccgggaaaccttggattatcactggggcaaa
catcacaaaacttatgtagagaacctgaacaagcaaatcttaggcacggatctagatgca
ttatccttggaagaagttgtgcttctttcatacaacaaaggcaatatgcttcctgctttc
aacaacgctgcacaggcttggaaccacgagttcttctgggagtctatccaacctggaggt
ggaggaaagccaactggagagctcctcagattaatagaaagagattttgggtctttcgaa
gagtttttggaaaggttcaagtcggctgcagcttcgaattttggttcgggttggacatgg
cttgcatataaggcgaatagacttgacgttgcaaatgccgttaatcctctcccaaaggag
gaagacaagaaacttgttatagtgaagacgcccaatgcagtaaatccgctcgtatgggat
tattctccacttctcaccattgatacctgggagcacgcttactatctggattttgagaac
cgaagagctgaatacataaatacattcatggaaaagcttgtgtcatgggaaactgtaagc
acaaggttggaatccgcaattgctcgagcagtgcaaagagaacaagaaggaacagagaca
gaagatgaagagaatccagatgatgaagtaccagaggtctatttagatagtgacatcgat
gtatctgaggttgactaa

DBGET integrated database retrieval system