KEGG   Arabidopsis thaliana (thale cress): AT1G10430
Entry
AT1G10430         CDS       T00041                                 
Symbol
PP2A-2
Name
(RefSeq) protein phosphatase 2A-2
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03015  mRNA surveillance pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    AT1G10430 (PP2A-2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT1G10430 (PP2A-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ath01009]
    AT1G10430 (PP2A-2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT1G10430 (PP2A-2)
   04131 Membrane trafficking [BR:ath04131]
    AT1G10430 (PP2A-2)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT1G10430 (PP2A-2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT1G10430 (PP2A-2)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AT1G10430 (PP2A-2)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     AT1G10430 (PP2A-2)
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     AT1G10430 (PP2A-2)
Membrane trafficking [BR:ath04131]
 Autophagy
  Other autophagy associated proteins
   Others
    AT1G10430 (PP2A-2)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     AT1G10430 (PP2A-2)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT1G10430 (PP2A-2)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 837583
NCBI-ProteinID: NP_001322206
TAIR: AT1G10430
UniProt: Q07098 A0A178W6R4
LinkDB
Position
1:complement(3428478..3430924)
AA seq 306 aa
MPSNGDLDRQIEQLMECKPLSEADVRTLCDQARAILVEEYNVQPVKCPVTVCGDIHGQFY
DLIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRDRLTILRGNHESRQI
TQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRSL
DRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIAAQFNHNNGLSLISRAHQL
VMEGFNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMEQNFLQFDPAPRQVEPDTTRK
TPDYFL
NT seq 921 nt   +upstreamnt  +downstreamnt
atgccgtcgaacggagatctggaccgtcagatcgagcagctgatggagtgtaaaccgtta
tcggaggcggatgtgaggacgctttgcgatcaagcgagagcgatccttgtcgaggaatat
aatgttcagccggtgaagtgtcctgttaccgtttgcggcgatattcacggccagttttat
gaccttattgagctctttcgtatcggtggcaacgctcctgatactaactacctcttcatg
ggagactatgtagatcgtggctactattcagtagagacagtttctctattggtggcacta
aaagtgcgatacagggatagacttacaatcttacgagggaatcacgagagtcggcagatt
actcaagtctatggtttttatgacgaatgcttgaggaagtacggaaatgctaacgtctgg
aagtattttacagaccttttcgattatcttcctcttaccgccctcatagagagtcaggtt
ttctgtttgcatggagggctttcaccttctctggatactcttgataatatccgaagcttg
gatcggatacaggaggttccacacgaaggacctatgtgtgatttattatggtctgatcct
gatgatcgatgtggatggggaatatctccacgaggtgctggttatacatttggacaggat
atcgcagctcaatttaatcacaacaatggactaagtctcatatcaagagcgcatcaactt
gtcatggaaggttttaactggtgtcaggataagaatgtggtgactgtgtttagtgcacca
aactattgctaccggtgtggaaacatggctgccattctagagataggagagaacatggag
caaaacttcctccagttcgatccagctcctcgacaagttgaacctgatactactcggaag
acccctgattattttttgtga

KEGG   Arabidopsis thaliana (thale cress): AT1G59830
Entry
AT1G59830         CDS       T00041                                 
Symbol
PP2A-1
Name
(RefSeq) protein phosphatase 2A-2
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03015  mRNA surveillance pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    AT1G59830 (PP2A-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT1G59830 (PP2A-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ath01009]
    AT1G59830 (PP2A-1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT1G59830 (PP2A-1)
   04131 Membrane trafficking [BR:ath04131]
    AT1G59830 (PP2A-1)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT1G59830 (PP2A-1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT1G59830 (PP2A-1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AT1G59830 (PP2A-1)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     AT1G59830 (PP2A-1)
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     AT1G59830 (PP2A-1)
Membrane trafficking [BR:ath04131]
 Autophagy
  Other autophagy associated proteins
   Others
    AT1G59830 (PP2A-1)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     AT1G59830 (PP2A-1)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT1G59830 (PP2A-1)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 842276
NCBI-ProteinID: NP_176192
TAIR: AT1G59830
UniProt: Q07099 A0A654EK18
LinkDB
Position
1:complement(22020377..22022503)
AA seq 306 aa
MPLNGDLDRQIEQLMECKPLGEADVKILCDQAKAILVEEYNVQPVKCPVTVCGDIHGQFY
DLIELFRIGGNAPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRDRLTILRGNHESRQI
TQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRSL
DRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIATQFNHNNGLSLISRAHQL
VMEGYNWCQEKNVVTVFSAPNYCYRCGNMAAILEIGEKMEQNFLQFDPAPRQVEPDTTRK
TPDYFL
NT seq 921 nt   +upstreamnt  +downstreamnt
atgccgttaaacggagatctcgaccgtcagatcgaacagctaatggagtgtaagccgtta
ggtgaagcagacgtgaagatcctttgcgatcaagctaaagcgattcttgttgaggaatat
aatgttcaaccggttaagtgtccggttacggtatgcggcgatatccatggccagttttat
gacctaattgagctatttcgtattggtggtaatgctcctgatactaattacctcttcatg
ggagattatgtagatcgtggctactattctgtagaaacagtctctctattggtggcatta
aaggtgcgttacagggacagacttacgatcctgcgagggaatcatgagagccgtcagatt
acacaagtctatggtttttatgacgaatgcttgaggaaatacggaaatgcaaatgtgtgg
aagtattttacggaccttttcgattatctccctcttacagcactcatagagagtcaggtt
ttctgtttgcatggaggcctttcaccttctctggatactcttgacaatatccgaagcttg
gatcgaatacaagaggttccacacgaaggaccaatgtgcgatctactctggtctgatccc
gacgatcgttgtggatggggaatatctcctcgtggtgctggttacacgtttggacaggac
attgctactcagtttaatcataacaatggactgagtctgatctcaagagcgcatcaactt
gtaatggaaggctataattggtgtcaggaaaagaacgtagtgacagtgtttagtgcaccg
aactactgttacagatgtggaaacatggccgcaattcttgagattggagaaaagatggaa
cagaacttccttcaattcgatccagcacctagacaagtcgaacccgataccacgcgcaag
acccctgattattttttgtga

KEGG   Arabidopsis thaliana (thale cress): AT1G69960
Entry
AT1G69960         CDS       T00041                                 
Symbol
PP2A
Name
(RefSeq) serine/threonine protein phosphatase 2A
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03015  mRNA surveillance pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    AT1G69960 (PP2A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT1G69960 (PP2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ath01009]
    AT1G69960 (PP2A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT1G69960 (PP2A)
   04131 Membrane trafficking [BR:ath04131]
    AT1G69960 (PP2A)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT1G69960 (PP2A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT1G69960 (PP2A)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AT1G69960 (PP2A)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     AT1G69960 (PP2A)
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     AT1G69960 (PP2A)
Membrane trafficking [BR:ath04131]
 Autophagy
  Other autophagy associated proteins
   Others
    AT1G69960 (PP2A)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     AT1G69960 (PP2A)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT1G69960 (PP2A)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 843333
NCBI-ProteinID: NP_177154
TAIR: AT1G69960
UniProt: O04951 A0A178WFY3
LinkDB
Position
1:complement(26348721..26350697)
AA seq 307 aa
MPPATGDIDRQIEQLMECKALSETEVKMLCEHAKTILVEEYNVQPVKCPVTVCGDIHGQF
YDLIELFRIGGSSPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRDRLTILRGNHESRQ
ITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQVFCLHGGLSPSLDTLDNIRS
LDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIATQFNHTNGLSLISRAHQ
LVMEGFNWCQEKNVVTVFSAPNYCYRCGNMAAILEIGENMDQNFLQFDPAPRQVEPETTR
KTPDYFL
NT seq 924 nt   +upstreamnt  +downstreamnt
atgccgccggcgaccggagatatcgatcgtcagatcgagcagcttatggagtgtaaagcg
ttatctgaaacggaggtgaagatgttgtgtgagcacgcaaagacgattcttgtggaagag
tataatgttcaaccggttaaatgtccggttaccgtctgcggtgatatccacggccaattt
tacgatctaatcgagctttttcgtatcggtggttcttctcctgatactaattatcttttc
atgggtgattatgttgatcgagggtattattctgtggagacagtctcacttttggtagca
ctgaaagttcgttacagagatagacttactatcctaagagggaatcatgaaagccgtcaa
attactcaagtgtatgggttttatgatgaatgtttgaggaaatatggaaatgctaatgta
tggaagcacttcactgatctttttgattatcttccacttacagctcttattgagagtcag
gttttctgtttacatggaggactttcaccttctttagatacacttgacaacatccgatct
ttagatcgaattcaagaggttccacatgaaggaccaatgtgtgatctcttatggtctgat
ccagatgaccgatgcggttggggaatatctcctcgtggtgcaggctacactttcggacaa
gatatcgctactcagtttaaccacaccaatggactctctctgatttcaagagcacatcaa
cttgtcatggaaggttttaattggtgccaagaaaagaacgttgtgactgtatttagtgcc
ccaaactattgctaccgttgtggcaacatggctgcgattctagagatcggtgagaacatg
gaccagaatttccttcagtttgatccagctccacgtcaagtcgaacccgaaaccactcgc
aagactccagattattttttgtaa

KEGG   Arabidopsis thaliana (thale cress): AT2G42500
Entry
AT2G42500         CDS       T00041                                 
Symbol
PP2A-3
Name
(RefSeq) protein phosphatase 2A-3
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03015  mRNA surveillance pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    AT2G42500 (PP2A-3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT2G42500 (PP2A-3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ath01009]
    AT2G42500 (PP2A-3)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT2G42500 (PP2A-3)
   04131 Membrane trafficking [BR:ath04131]
    AT2G42500 (PP2A-3)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT2G42500 (PP2A-3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT2G42500 (PP2A-3)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AT2G42500 (PP2A-3)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     AT2G42500 (PP2A-3)
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     AT2G42500 (PP2A-3)
Membrane trafficking [BR:ath04131]
 Autophagy
  Other autophagy associated proteins
   Others
    AT2G42500 (PP2A-3)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     AT2G42500 (PP2A-3)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT2G42500 (PP2A-3)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 818850
NCBI-ProteinID: NP_565974
TAIR: AT2G42500
UniProt: Q07100 A0A178VSM5
LinkDB
Position
2:complement(17697626..17701417)
AA seq 313 aa
MGANSIPTDATIDLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICG
DIHGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETVTLLVALKMRYPQRITILRG
NHESRQITQVYGFYDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIET
LDNIRNFDRVQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISEQFNHTNNLKL
IARAHQLVMDGYNWAHEQKVVTIFSAPNYCYRCGNMASILEVDDCRNHTFIQFEPAPRRG
EPDVTRRTPDYFL
NT seq 942 nt   +upstreamnt  +downstreamnt
atgggcgcgaattctattccgacggacgcaaccattgatcttgatgagcagatctcgcag
ctcatgcagtgcaagcctctctcggagcaacaggttagagcattatgcgagaaagccaag
gagatcttaatggatgaaagcaatgttcagcctgtgaaaagccctgtgacaatctgcggt
gatattcatggacagttccatgatcttgcagagcttttccgtatagggggaatgtgccct
gataccaattacctgtttatgggagactatgtggaccgtggttattattctgttgaaact
gttacgctgttagtcgccttaaagatgcgatatcctcagcgaatcactattcttagagga
aaccatgaaagtcgtcagattactcaggtttatggattttatgatgaatgtctacgaaag
tacggcaacgcaaatgtttggaaaatctttacagacctcttcgactattttcctctgaca
gccttggttgagtcagaaatattttgccttcatggtggattatctccatctatcgagacc
cttgacaacataaggaattttgatcgagttcaagaagtgccccatgaagggccgatgtgt
gacttattatggtctgaccccgatgaccgatgtggttggggcatctctcctcggggtgcc
ggatatacatttggtcaggatatatctgaacaattcaatcacacaaacaacttaaagctg
atcgcccgagctcaccagttggttatggatggatacaactgggctcacgagcaaaaagtg
gttactattttcagtgcaccaaactattgttaccgttgtgggaacatggcctcgattctt
gaggtcgacgactgcaggaaccacaccttcatccagtttgaaccagcaccgaggagagga
gaaccagacgtcacccgaaggactccagactatttcctgtga

KEGG   Arabidopsis thaliana (thale cress): AT3G58500
Entry
AT3G58500         CDS       T00041                                 
Symbol
PP2A-4
Name
(RefSeq) protein phosphatase 2A-4
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03015  mRNA surveillance pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    AT3G58500 (PP2A-4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT3G58500 (PP2A-4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ath01009]
    AT3G58500 (PP2A-4)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT3G58500 (PP2A-4)
   04131 Membrane trafficking [BR:ath04131]
    AT3G58500 (PP2A-4)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT3G58500 (PP2A-4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT3G58500 (PP2A-4)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AT3G58500 (PP2A-4)
Protein phosphatases and associated proteins [BR:ath01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     AT3G58500 (PP2A-4)
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     AT3G58500 (PP2A-4)
Membrane trafficking [BR:ath04131]
 Autophagy
  Other autophagy associated proteins
   Others
    AT3G58500 (PP2A-4)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     AT3G58500 (PP2A-4)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AT3G58500 (PP2A-4)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 825019
NCBI-ProteinID: NP_567066
TAIR: AT3G58500
UniProt: P48578 A0A178VCH8
LinkDB
Position
3:complement(21635162..21639136)
AA seq 313 aa
MGANSLPTDATLDLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICG
DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVGLKVRYPQRITILRG
NHESRQITQVYGFYDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIET
LDNIRNFDRVQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISEQFNHTNNLKL
IARAHQLVMDGFNWAHEQKVVTIFSAPNYCYRCGNMASILEVDDCRNHTFIQFEPAPRRG
EPDVTRRTPDYFL
NT seq 942 nt   +upstreamnt  +downstreamnt
atgggcgcgaattcgcttccaacggatgcaaccctcgatctagatgagcagatctcgcag
ctcatgcagtgcaagcctctctccgagcaacaggtcagagcattatgtgagaaagctaag
gagatcttaatggatgaaagcaacgttcagcctgttaaaagccctgtgacaatctgcggt
gatattcatggacagttccatgatcttgcagagcttttccgtattgggggaaagtgtcct
gataccaactatctgtttatgggagactatgtcgaccgtggatattattctgtggaaact
gttacgctgttggttggcttgaaagtacggtatccacagcgaatcactattcttagagga
aaccatgaaagtcgtcagattactcaggtttatggattttatgatgaatgtctgcgaaag
tatggcaatgcaaatgtttggaagatatttacagacctctttgactatttcccactgaca
gccttggtggagtcggaaatattctgccttcacggtggattatcaccatccatcgagacc
cttgacaacattaggaactttgatcgggttcaagaagttccacatgaagggcctatgtgt
gacttattatggtctgatcctgatgacagatgtggctggggaatctctcctcgtggtgct
ggatatacatttggtcaggatatttcggaacaattcaatcacactaacaacttaaagctg
atcgcccgagcgcatcagctcgttatggatggattcaattgggcacacgagcaaaaagtg
gttactatattcagtgcaccaaactattgctatcgctgtggaaacatggcctcaattctt
gaggtcgatgactgcaggaaccacacgttcattcagtttgaaccagcaccgaggagagga
gagccagatgtaacccgaaggacacctgactatttcctttga

DBGET integrated database retrieval system