KEGG   Arabidopsis thaliana (thale cress): AT1G18590
Entry
AT1G18590         CDS       T00041                                 
Symbol
SOT17
Name
(RefSeq) sulfotransferase 17
  KO
K22321  aliphatic desulfoglucosinolate sulfotransferase [EC:2.8.2.38]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00966  Glucosinolate biosynthesis
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    AT1G18590 (SOT17)
Enzymes [BR:ath01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.38  aliphatic desulfoglucosinolate sulfotransferase
     AT1G18590 (SOT17)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3
Other DBs
NCBI-GeneID: 838440
NCBI-ProteinID: NP_173294
TAIR: AT1G18590
UniProt: Q9FZ80 A0A384KIF3 M1FZP1
LinkDB
Position
1:6398531..6400029
AA seq 346 aa
MESKTINDVVVSESNHELASSSPSEFEKNQKHYQEIIATLPHKDGWRPKDPFVEYGGHWW
LQPLLEGLLHAQKFFKARPNDFFVCSYPKTGTTWLKALTFAIANRSKFDVSTNPLLKRNP
HEFVPYIEIDFPFFPSVDVLKDEGNTLFSTHIPYDLLPESVVKSGCKIVYIWRDPKDTFV
SMWTFAHKERSQQGPVVSIEEAFDKYCQGLSAYGPYLDHVLGYWKAYQANPDQILFLKYE
TMRADPLPYVKRLAEFMGYGFTKEEEEGNVVEKVVKLCSFETLKNLEANKGEKDREDRPA
VYANSAYFRKGKVGDWQNYLTPEMVARIDGLMEEKFKGTGFLSSKS
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggaatccaaaaccataaacgacgtcgtcgtatcagagtcaaatcacgagttagcatct
tcgtcgccatcagaatttgagaagaaccagaaacattaccaagaaatcatcgcaactctt
cctcacaaagatggctggagaccaaaagatccgttcgttgagtacggtggtcactggtgg
ctacaacctcttcttgaaggtttacttcacgcccagaagttcttcaaggcacgtcccaat
gatttcttcgtctgcagctacccaaaaaccggcacgacttggctcaaagccttaactttc
gcaatcgcaaatcgctccaagttcgacgtttcaacaaaccctcttctcaaacgtaatcca
cacgagtttgtgccttacatcgaaatcgacttcccgtttttcccaagcgttgatgttctt
aaagacgaaggaaacacgcttttctcgactcatatcccttatgatctcttacctgaatca
gttgtgaaatctggttgcaagattgtttacatatggagagacccaaaggacacgtttgtg
tcgatgtggacttttgctcacaaggagagatcacaacaaggaccagtggttagcattgag
gaagcttttgataagtactgtcaaggtttatcagcttacggtccttatcttgatcatgtt
ttagggtattggaaagcttaccaagcaaacccggatcagattttgtttctcaagtatgag
acaatgagagctgatccattgccttatgtgaagagattagctgagtttatgggttatggg
ttcacgaaggaggaagaggagggaaatgttgttgagaaagtagtgaagctttgtagcttt
gagactttgaagaatcttgaagctaacaaaggtgagaaagatagagaagatcgtcctgct
gtttatgccaacagtgcgtatttcaggaaagggaaagttggggattggcagaattatctg
actccggagatggtggctcgtattgatggtttgatggaagagaagtttaaaggaactggc
tttctttcttcaaaatcatga

DBGET integrated database retrieval system