KEGG   Arabidopsis thaliana (thale cress): AT1G22770
Entry
AT1G22770         CDS       T00041                                 
Symbol
GI
Name
(RefSeq) gigantea protein (GI)
  KO
K12124  GIGANTEA
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT1G22770 (GI)
SSDB
Other DBs
NCBI-GeneID: 838883
NCBI-ProteinID: NP_564180
TAIR: AT1G22770
UniProt: Q9SQI2 Q68KJ4 A0A654ED90
LinkDB
Position
1:8061751..8067790
AA seq 1173 aa
MASSSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQ
YPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSS
ENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTERNCLSKATTSGSPTSEPKAGSPT
QHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIASRGSGKHPQ
LMPSTPRWAVANGAGVILSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPA
LEPYARLFHRYYAIATPSATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVR
LPRNWMHLHFLRAIGIAMSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPI
GGYSSNYRKQIEVPAAEATIEATAQGIASMLCAHGPEVEWRICTIWEAAYGLIPLNSSAV
DLPEIIVATPLQPPILSWNLYIPLLKVLEYLPRGSPSEACLMKIFVATVETILSRTFPPE
SSRELTRKARSSFTTRSATKNLAMSELRAMVHALFLESCAGVELASRLLFVVLTVCVSHE
AQSSGSKRPRSEYASTTENIEANQPVSNNQTANRKSRNVKGQGPVAAFDSYVLAAVCALA
CEVQLYPMISGGGNFSNSAVAGTITKPVKINGSSKEYGAGIDSAISHTRRILAILEALFS
LKPSSVGTPWSYSSSEIVAAAMVAAHISELFRRSKALTHALSGLMRCKWDKEIHKRASSL
YNLIDVHSKVVASIVDKAEPLEAYLKNTPVQKDSVTCLNWKQENTCASTTCFDTAVTSAS
RTEMNPRGNHKYARHSDEGSGRPSEKGIKDFLLDASDLANFLTADRLAGFYCGTQKLLRS
VLAEKPELSFSVVSLLWHKLIAAPEIQPTAESTSAQQGWRQVVDALCNVVSATPAKAAAA
VVLQAERELQPWIAKDDEEGQKMWKINQRIVKVLVELMRNHDRPESLVILASASDLLLRA
TDGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSH
PSAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFNAASIDWKADIQNC
LNWEAHSLLSTTMPTQFLDTAARELGCTISLSQ
NT seq 3522 nt   +upstreamnt  +downstreamnt
atggctagttcatcttcatctgagagatggatcgatggtcttcagttctcttccttgtta
tggcctccgccacgagatcctcaacaacataaggatcaagtcgttgcttatgttgaatat
tttggtcaatttacatcagagcaattcccagatgacattgctgagttggtccggcatcag
tatccatcaactgagaagcgacttttagacgatgtgctggcgatgtttgtccttcatcat
ccggagcatggtcatgcagtcattcttccaatcatttcatgtcttattgatggctcgttg
gtgtacagcaaggaagctcatccgtttgcctctttcatatctttagtttgcccaagtagt
gagaatgactattcggagcaatgggctttggcatgtggagaaatccttcgcattttgact
cattacaaccgtcccatttataaaactgagcagcaaaatggagatacagagagaaattgt
ctgagcaaagctacaactagtggttctccgacttcagagcctaaggctggatcaccaaca
cagcatgaaaggaaacctttaaggcctttgtctccatggatcagtgatatactacttgct
gctcctcttggtataagaagtgactatttccgatggtgtagtggtgtaatgggtaaatat
gctgctggagagctcaagccgccaaccattgcttctcgaggatctggtaaacatcctcaa
ctgatgccttcaaccccaagatgggctgttgctaatggagctggtgtcatactgagtgtt
tgtgatgatgaagttgctcgatatgagactgctacgctgacagcggtcgctgtccctgca
cttcttcttcctccgccaacgacatccttagatgagcatctagttgctggccttccagct
cttgaaccatatgcacgtttgtttcatagatactatgccattgcaactccaagtgctacg
cagagacttcttcttggactcttagaagcaccaccgtcgtgggctccagatgcacttgat
gctgctgtacagcttgtggaactccttcgagctgctgaagattatgcatctggtgtaagg
ctacccaggaactggatgcatttgcacttcttgcgggctataggaattgctatgtctatg
agggcaggtgttgctgctgatgctgcagccgctttgcttttccgcatactctcacagccg
gcactgctttttcctccgctaagtcaagttgagggagtagaaattcagcacgcgcctatt
ggtggctacagttcaaattacagaaaacagatagaagttcctgcagcagaagcaaccatt
gaagccactgcccaaggaattgcctcaatgctttgtgctcatggtcctgaagttgagtgg
agaatttgcactatatgggaagctgcttatggtttgatccctttaaattcttcggcggtt
gatcttcccgaaatcatagttgctaccccactgcaacctcctatcttgtcatggaattta
tacattccactcctcaaagtacttgaatatcttccacgggggagtccttcggaagcatgc
ttgatgaaaatatttgttgccactgtggaaacaatactcagtagaacttttccgcctgaa
tcttccagggaactaaccagaaaagctagatcgagttttaccacaagatcagcgaccaaa
aatcttgctatgtctgagcttcgtgctatggtccatgctctctttttagaatcatgcgct
ggtgtggaattagcttcacgcctactttttgttgtgttgactgtatgtgttagccatgaa
gcacagtctagtggtagcaagagaccgagaagtgaatatgctagtactactgaaaatatt
gaggcgaatcaacctgtatctaacaatcaaactgctaaccgtaaaagtaggaatgtcaag
ggacagggacctgtggcagcatttgattcatacgttcttgctgctgtttgtgctcttgcc
tgtgaggttcagctgtatcctatgatctctggtggggggaacttttccaattctgccgtg
gctggaactattacaaagcctgtaaagataaatgggtcatctaaagagtatggagctggg
attgactcggcaattagtcatacgcgccgaattttggcaatcctagaggcactcttttca
ttaaaaccatcttctgtggggactccatggagttacagttctagtgagatagttgctgcg
gccatggttgcagctcatatttccgaactgttcagacgttcaaaggccttgacgcatgca
ttgtctgggttgatgagatgtaagtgggataaggaaattcataaaagagcatcatcatta
tataacctcatagatgttcacagcaaagttgttgcctccattgttgacaaagctgaaccc
ttggaagcctaccttaagaatacaccggttcagaaggattctgtgacctgtttaaactgg
aaacaagagaacacatgtgcaagcaccacatgctttgatacagcggtgacatccgcctca
aggactgaaatgaatccaagaggaaaccataagtatgctagacattcagatgaaggctca
gggagaccctcagagaagggtatcaaagatttcctcttggatgcttctgatcttgcgaat
ttcctcacagctgatagactcgcagggttctattgtggtacacaaaagcttttgaggtca
gtgcttgcagagaaaccggagctgtctttctccgttgtttcactgttatggcacaaactg
attgctgctcctgaaatccagcccaccgcagaaagcacctctgcgcaacaaggatggaga
caggttgttgatgcgctatgcaatgtcgtatctgcaacgccagcgaaagcagcagcagca
gttgtccttcaggctgaaagggagttgcagccttggatcgccaaagatgatgaagaaggc
caaaaaatgtggaaaatcaaccaacggatagtcaaagtgttggtggaactcatgcgcaat
catgacaggcctgagtcactggtgattctcgcaagtgcatcagatcttcttctgcgggca
actgatggaatgcttgttgatggagaagcttgtacattacctcaacttgagctacttgaa
gccacggcaagagcaatacagccggtgctagcttgggggccatctggactagcagtggtc
gacggtttatccaatctattgaagtgtcgtctaccagcaacaatacggtgcctttcacac
ccaagtgcacacgtacgtgccttaagcacgtcagtactacgtgatatcatgaaccaaagc
tccatacccatcaaagtaactccaaaactgccaacaacagagaagaacggaatgaatagt
ccgtcctatcgattcttcaacgccgcctcaatagactggaaagccgatatccaaaactgt
ttaaactgggaagctcacagcttgctctccacaactatgcctactcagtttctcgacact
gcggctcgggaactcggctgtactatatccttgtcccaataa

DBGET integrated database retrieval system