KEGG   Arabidopsis thaliana (thale cress): AT1G23800
Entry
AT1G23800         CDS       T00041                                 
Symbol
ALDH2B7
Name
(RefSeq) aldehyde dehydrogenase 2B7
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00053  Ascorbate and aldarate metabolism
ath00071  Fatty acid degradation
ath00280  Valine, leucine and isoleucine degradation
ath00310  Lysine degradation
ath00330  Arginine and proline metabolism
ath00340  Histidine metabolism
ath00380  Tryptophan metabolism
ath00410  beta-Alanine metabolism
ath00561  Glycerolipid metabolism
ath00620  Pyruvate metabolism
ath00770  Pantothenate and CoA biosynthesis
ath00903  Limonene and pinene degradation
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G23800 (ALDH2B7)
   00053 Ascorbate and aldarate metabolism
    AT1G23800 (ALDH2B7)
   00620 Pyruvate metabolism
    AT1G23800 (ALDH2B7)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT1G23800 (ALDH2B7)
   00561 Glycerolipid metabolism
    AT1G23800 (ALDH2B7)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT1G23800 (ALDH2B7)
   00310 Lysine degradation
    AT1G23800 (ALDH2B7)
   00330 Arginine and proline metabolism
    AT1G23800 (ALDH2B7)
   00340 Histidine metabolism
    AT1G23800 (ALDH2B7)
   00380 Tryptophan metabolism
    AT1G23800 (ALDH2B7)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT1G23800 (ALDH2B7)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT1G23800 (ALDH2B7)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AT1G23800 (ALDH2B7)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AT1G23800 (ALDH2B7)
SSDB
Motif
Pfam: Aldedh DUF1487
Other DBs
NCBI-GeneID: 838991
NCBI-ProteinID: NP_564204
TAIR: AT1G23800
UniProt: Q8S528 A0A654ECE7
LinkDB
Position
1:complement(8412051..8414886)
AA seq 534 aa
MASRRVSSLLSRSFMSSSRSIFSLRGMNRGAQRYSNLAAAVENTITPPVKVEHTQLLIGG
RFVDAVSGKTFPTLDPRNGEVIAQVSEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSKI
LFRFADLIEKHNDEIAALETWDNGKPYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGD
GPHHVQTLHEPIGVAGQIIPWNFPLLMLSWKLGPALACGNTVVLKTAEQTPLSALLVGKL
LHEAGLPDGVVNIVSGFGATAGAAIASHMDVDKVAFTGSTDVGKIILELASKSNLKAVTL
ELGGKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAL
KRNVGDPFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKGYYIQPTVFS
DVKDDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALR
VGTVWINCFDVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNPAWL
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggcatcaagaagagtttcttcgctgctctctcgctctttcatgtcctcctcacgttct
atcttctctcttagaggcatgaacagaggagctcaaagatacagtaacctcgctgctgct
gtcgaaaacactattactccaccagtgaaagttgaacacacacagcttctaatcggtgga
agattcgttgatgcagtgtcaggaaaaactttccctactttggatccaagaaatggagaa
gtgattgctcaagtgtctgaaggtgatgcagaagacgtgaaccgcgcggttgcagctgca
cgaaaggcttttgatgaaggaccatggcctaaaatgacagcttatgagagatcaaagata
ctgtttcgtttcgctgatttaatcgagaaacataatgatgagattgctgctcttgagact
tgggataatgggaaaccttatgaacaatctgctcaaattgaagtaccaatgcttgctagg
gtgttccggtactatgctggttgggcagacaagatacatggaatgacaatgccaggagat
ggtccacaccatgtgcagaccttacatgagcctataggagtcgctggacaaatcatccca
tggaacttccctcttctcatgctttcttggaaacttggaccagctttagcttgcggtaac
accgttgttctcaaaactgctgagcaaactcctctatctgctcttcttgttgggaaacta
cttcatgaggctggacttcctgatggagttgtgaatatagtttctggatttggggctact
gctggtgcagctatagctagtcacatggacgttgataaggttgctttcaccgggtctact
gatgttgggaagattattcttgagttagcttcaaaaagcaaccttaaggcagtgactctt
gagcttggaggaaagtcaccattcattgtatgtgaagatgctgatgtggatcaggccgtt
gagcttgcacatttcgctttgttctttaaccagggacaatgttgttgtgctggttcgcgt
acatttgtacatgaacgtgtgtatgatgagtttgtagagaaagctaaagctcgtgcactc
aagcgaaatgttggagatcccttcaagtcaggcattgagcaaggtccccaggtagactca
gagcaattcaacaaaatcctgaagtacatcaaacatggagttgaggctggagccacatta
caagctggaggtgacaggcttggttccaagggttactacattcaacctactgtcttctca
gatgtgaaagatgacatgctcatagcaacagacgagattttcgggccggttcaaaccata
ctgaaattcaaggatcttgatgaggtgattgcaagggccaacaactcaaggtacggttta
gctgctggagtgttcacacagaatcttgacacagcacaccggctgatgcgagcactcaga
gttgggactgtttggatcaactgttttgatgtacttgatgcatcaattccatttggaggg
tataagatgagtggcattggtagagagaaaggtatctacagtctcaacaattacttgcaa
gtcaaggctgttgttacttccctcaagaaccctgcctggctctaa

KEGG   Arabidopsis thaliana (thale cress): AT1G44170
Entry
AT1G44170         CDS       T00041                                 
Symbol
ALDH3H1
Name
(RefSeq) aldehyde dehydrogenase 3H1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00053  Ascorbate and aldarate metabolism
ath00071  Fatty acid degradation
ath00280  Valine, leucine and isoleucine degradation
ath00310  Lysine degradation
ath00330  Arginine and proline metabolism
ath00340  Histidine metabolism
ath00380  Tryptophan metabolism
ath00410  beta-Alanine metabolism
ath00561  Glycerolipid metabolism
ath00620  Pyruvate metabolism
ath00770  Pantothenate and CoA biosynthesis
ath00903  Limonene and pinene degradation
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G44170 (ALDH3H1)
   00053 Ascorbate and aldarate metabolism
    AT1G44170 (ALDH3H1)
   00620 Pyruvate metabolism
    AT1G44170 (ALDH3H1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT1G44170 (ALDH3H1)
   00561 Glycerolipid metabolism
    AT1G44170 (ALDH3H1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT1G44170 (ALDH3H1)
   00310 Lysine degradation
    AT1G44170 (ALDH3H1)
   00330 Arginine and proline metabolism
    AT1G44170 (ALDH3H1)
   00340 Histidine metabolism
    AT1G44170 (ALDH3H1)
   00380 Tryptophan metabolism
    AT1G44170 (ALDH3H1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT1G44170 (ALDH3H1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT1G44170 (ALDH3H1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AT1G44170 (ALDH3H1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AT1G44170 (ALDH3H1)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 841020
NCBI-ProteinID: NP_175081
TAIR: AT1G44170
UniProt: Q70DU8 A0A178W2A3
LinkDB
Position
1:complement(16796400..16800321)
AA seq 484 aa
MAAKKVFGSAEASNLVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRDDL
GKPELESSVYEVSLLRNSIKLALKQLKNWMAPEKAKTSLTTFPASAEIVSEPLGVVLVIS
AWNYPFLLSIDPVIGAISAGNAVVLKPSELAPASSALLTKLLEQYLDPSAVRVVEGAVTE
TSALLEQKWDKIFYTGSSKIGRVIMAAAAKHLTPVVLELGGKSPVVVDSDTDLKVTVRRI
IVGKWGCNNGQACVSPDYILTTKEYAPKLIDAMKLELEKFYGKNPIESKDMSRIVNSNHF
DRLSKLLDEKEVSDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNN
LEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGE
SGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVL
LGLA
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggctgcgaagaaggtttttggatcggcggaagcgagtaatttggtgacggagcttcgt
cggagttttgatgatggtgtgacacgtggttatgaatggagagtgactcagcttaagaaa
ctgatgattatttgtgataatcatgagcctgagatcgtcgcggctcttcgcgatgatctt
ggtaagcctgagcttgaatcttctgtttatgaggtatctctactgagaaactctatcaag
ttggctcttaagcagctaaagaactggatggctccggagaaggcaaagacttctctaaca
acgtttcctgcatccgcggagattgtgtctgagcctcttggtgttgtgctagtgatctcg
gcttggaactatccttttctgttgtctattgatcctgttattggtgcaatttctgctggg
aatgctgttgttttaaagccatcagaattggctccagcttcgtcagctctgctcactaag
ttactggaacagtatcttgatccttctgcggtgcgagttgtcgaaggagctgttaccgaa
acaagtgctctgctagagcagaagtgggacaagatattctacacaggtagttcaaaaatc
ggacgtgtcataatggcggcagctgcgaagcatctcacaccggttgttctagagcttgga
ggaaaatctcctgtcgttgtagactcggataccgatttgaaagttaccgtcaggcggata
atcgtaggcaaatggggttgtaacaacggacaggcgtgcgtttcgccggactatatcttg
acgacaaaagaatatgctcctaaattgattgatgccatgaagcttgaattggagaaattt
tatgggaagaaccctatagagtcgaaagatatgtcacgtatcgtaaactcgaatcacttt
gatcgcttgtctaagttgttagacgagaaggaagtttctgacaaaattgtctatggtggt
gaaaaggacagagaaaacttgaaaattgctccgacaatcttgctcgatgtaccattagat
tctctgatcatgagtgaagaaatatttggccctctccttccaatcctcacgcttaacaac
ttggaagagagctttgacgtgattcgttctcgacctaagccacttgcggcatacttgttt
acacataacaagaagttgaaagagagattcgcagcgacagtctccgctggaggcatagta
gtcaatgacatagctgttcatcttgcacttcacacattgccattcggaggagttggtgaa
agtggaatgggtgcttaccatggtaaattctcatttgatgcttttagtcacaagaaggcg
gttctctacagaagccttttcggtgattcagccgtcaggtatccgccatactcgagagga
aagcttagattgttaaaagcccttgtcgacagcaatatattcgatttattcaaagtcctt
ctcggtttagcttaa

KEGG   Arabidopsis thaliana (thale cress): AT1G54100
Entry
AT1G54100         CDS       T00041                                 
Symbol
ALDH7B4
Name
(RefSeq) aldehyde dehydrogenase 7B4
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00053  Ascorbate and aldarate metabolism
ath00071  Fatty acid degradation
ath00260  Glycine, serine and threonine metabolism
ath00280  Valine, leucine and isoleucine degradation
ath00310  Lysine degradation
ath00330  Arginine and proline metabolism
ath00340  Histidine metabolism
ath00380  Tryptophan metabolism
ath00410  beta-Alanine metabolism
ath00561  Glycerolipid metabolism
ath00620  Pyruvate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G54100 (ALDH7B4)
   00053 Ascorbate and aldarate metabolism
    AT1G54100 (ALDH7B4)
   00620 Pyruvate metabolism
    AT1G54100 (ALDH7B4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT1G54100 (ALDH7B4)
   00561 Glycerolipid metabolism
    AT1G54100 (ALDH7B4)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G54100 (ALDH7B4)
   00280 Valine, leucine and isoleucine degradation
    AT1G54100 (ALDH7B4)
   00310 Lysine degradation
    AT1G54100 (ALDH7B4)
   00330 Arginine and proline metabolism
    AT1G54100 (ALDH7B4)
   00340 Histidine metabolism
    AT1G54100 (ALDH7B4)
   00380 Tryptophan metabolism
    AT1G54100 (ALDH7B4)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT1G54100 (ALDH7B4)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AT1G54100 (ALDH7B4)
    1.2.1.8  betaine-aldehyde dehydrogenase
     AT1G54100 (ALDH7B4)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     AT1G54100 (ALDH7B4)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 841849
NCBI-ProteinID: NP_175812
TAIR: AT1G54100
UniProt: Q9SYG7 A0A178W3F2
LinkDB
Position
1:complement(20194712..20199193)
AA seq 508 aa
MGSANNEYEFLSEIGLTSHNLGSYVAGKWQANGPLVSTLNPANNQPIAQVVEASLEDYEQ
GLKACEEAAKIWMQVTAPKRGDIVRQIGDALRSKLDYLGRLLSLEMGKILAEGIGEVQEV
IDMCDFAVGLSRQLNGSVIPSERPNHMMLEMWNPLGIVGVITAFNFPCAVLGWNACIALV
CGNCVVWKGAPTTPLITIAMTKLVAEVLEKNNLPGAIFTAMCGGAEIGEAIAKDTRIPLV
SFTGSSRVGSMVQQTVNARSGKTLLELSGNNAIIVMDDADIQLAARSVLFAAVGTAGQRC
TTCRRLLLHESVYDKVLEQLLTSYKQVKIGNPLEKGTLLGPLHTPESKKNFEKGIEVIKS
QGGKILTGGKAVEGEGNFVEPTIIEISADAAVVKEELFAPVLYVLKFKSFGEAVAINNSV
PQGLSSSIFTRNPENIFRWIGPLGSDCGIVNVNIPTNGAEIGGAFGGEKATGGGREAGSD
SWKQYMRRSTCTINYGNELPLAQGINFG
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgggttcggcgaacaacgagtacgagtttctgagtgagattgggctgacttctcacaac
ttgggatcttacgttgctggcaaatggcaagccaacggacctcttgtttcaactctcaat
cctgctaacaatcagccaattgctcaagttgtggaagcttctctagaggattacgagcaa
ggtttgaaagcttgcgaggaagcagctaaaatatggatgcaggttacggctcctaagaga
ggtgatatcgtcagacagattggggatgcactaagatccaaacttgactatcttggtcgt
cttctttctcttgaaatgggaaagatccttgctgaaggtattggagaagttcaggaagta
attgacatgtgtgattttgctgttggtttgagccgacaactcaatggatcggttatacct
tcagaacgccctaaccacatgatgttggagatgtggaatcctcttggcattgttggtgtt
atcacagcgtttaattttccctgtgcagttcttggttggaatgcttgtattgctcttgtc
tgtggaaactgtgtagtctggaaaggtgctccaactacaccgttaataactatcgcaatg
accaagctagtagctgaagttttagagaaaaacaacttacccggtgccatttttacggcc
atgtgtggtggtgctgaaattggtgaagcaatagccaaagacacacgcattcccttagta
tcctttactggaagctccagggtgggctcaatggtacaacaaacagtgaatgcgagatct
gggaaaactttgcttgagttgagtggaaacaatgcaatcatagtcatggacgatgctgat
atacagttagcggctcgatctgttctattcgctgcggttggaactgctggtcaacgttgc
acaacttgccgtaggctgcttttgcatgagagtgtctatgacaaagtactcgagcaactg
cttacctcatacaaacaagtcaaaatcggcaatcctcttgagaaagggacattgttagga
ccattacatactcctgaatcaaaaaagaactttgagaaaggaattgaagtcatcaaatcc
cagggtggtaaaatactaacgggaggtaaagcagtcgaaggtgaaggaaactttgtggag
cctacgataatcgagatatcagcagatgctgctgtcgtcaaagaagagctatttgctccg
gttctatatgttctaaagtttaagtcatttggagaggctgttgcgataaacaactcggtt
cctcaaggtctaagcagctcgatattcactcggaaccctgaaaacatcttcaggtggatc
ggaccactgggaagtgactgtggcattgtgaatgtgaacataccgacgaatggagctgag
attggtggagcttttggaggcgagaaagcgactggtggtggtcgtgaagctggaagcgac
tcatggaaacagtacatgcgtcgatcgacttgtaccatcaactatggaaacgagttacct
ctagcgcaaggaattaacttcggttag

KEGG   Arabidopsis thaliana (thale cress): AT3G48000
Entry
AT3G48000         CDS       T00041                                 
Symbol
ALDH2B4
Name
(RefSeq) aldehyde dehydrogenase 2B4
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00053  Ascorbate and aldarate metabolism
ath00071  Fatty acid degradation
ath00280  Valine, leucine and isoleucine degradation
ath00310  Lysine degradation
ath00330  Arginine and proline metabolism
ath00340  Histidine metabolism
ath00380  Tryptophan metabolism
ath00410  beta-Alanine metabolism
ath00561  Glycerolipid metabolism
ath00620  Pyruvate metabolism
ath00770  Pantothenate and CoA biosynthesis
ath00903  Limonene and pinene degradation
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT3G48000 (ALDH2B4)
   00053 Ascorbate and aldarate metabolism
    AT3G48000 (ALDH2B4)
   00620 Pyruvate metabolism
    AT3G48000 (ALDH2B4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT3G48000 (ALDH2B4)
   00561 Glycerolipid metabolism
    AT3G48000 (ALDH2B4)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT3G48000 (ALDH2B4)
   00310 Lysine degradation
    AT3G48000 (ALDH2B4)
   00330 Arginine and proline metabolism
    AT3G48000 (ALDH2B4)
   00340 Histidine metabolism
    AT3G48000 (ALDH2B4)
   00380 Tryptophan metabolism
    AT3G48000 (ALDH2B4)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT3G48000 (ALDH2B4)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT3G48000 (ALDH2B4)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AT3G48000 (ALDH2B4)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AT3G48000 (ALDH2B4)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 823955
NCBI-ProteinID: NP_190383
TAIR: AT3G48000
UniProt: Q9SU63
LinkDB
Position
3:complement(17716864..17720169)
AA seq 538 aa
MAARRVSSLLSRSFSASSPLLFRSQGRNCYNGGILRRFGTSSAAAEEIINPSVQVSHTQL
LINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAEDINRAVKAARTAFDEGPWPKMSAYE
RSRVLLRFADLVEKHSEELASLETWDNGKPYQQSLTAEIPMFARLFRYYAGWADKIHGLT
IPADGNYQVHTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQTPLTAFY
AGKLFLEAGLPPGVLNIVSGFGATAGAALASHMDVDKLAFTGSTDTGKVILGLAANSNLK
PVTLELGGKSPFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKSK
ARALKRVVGDPFRKGIEQGPQIDLKQFEKVMKYIKSGIESNATLECGGDQIGDKGYFIQP
TVFSNVKDDMLIAQDEIFGPVQSILKFSDVDEVIKRANETKYGLAAGVFTKNLDTANRVS
RALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggcggctcgtagagtgtcttctcttttatctcgatctttttcagcttcctctccctta
ctgtttcgttctcaagggagaaattgttacaatggagggatcttaaggagatttggaacc
tcttctgctgctgctgaggaaatcataaacccatctgttcaagtttctcacacacagctc
ctcatcaatgggaactttgttgactctgcttctggtaagacgtttccgactcttgatccg
aggacaggcgaagtcattgctcatgtagctgaaggcgatgctgaagatatcaatcgagct
gtgaaagctgcaaggacggcctttgatgaaggaccttggcctaaaatgagtgcttatgaa
aggtcaagagttttgttgaggtttgcagatttggttgagaaacacagcgaagagctcgcg
tctctagagacatgggacaatggcaagccttaccaacaatccttgaccgcagagattccc
atgtttgcaagattgttccgttactatgctggatgggcggataagattcatggactaaca
attccagctgatggaaactatcaagttcacacattacatgaaccgataggtgtagctgga
cagatcataccgtggaattttccacttttgatgtttgcttggaaagttggtcctgctctt
gcttgtggtaacaccattgtcctcaaaaccgctgagcaaacacctctcacggctttctat
gctggaaagcttttccttgaagcgggtcttcctcctggtgttctgaatattgtttcggga
ttcggtgcaacagcaggtgctgccctcgcgagtcatatggatgtagacaagcttgctttt
acaggatcgactgatacggggaaagttatacttggattggctgctaacagcaatcttaag
cccgtaactctggaacttggagggaaatcaccgttcatcgtattcgaagatgctgatatt
gataaagctgtagagcttgcacactttgccctcttcttcaaccaggggcaatgttgctgc
gcggggtctcggacatttgttcatgagaaagtgtatgatgagtttgttgagaaatcaaag
gcacgcgcattgaaacgtgttgttggtgatcctttcaggaaaggcattgaacagggtcct
cagatcgatttgaagcaatttgagaaagtgatgaagtacataaagtcaggtatcgaaagc
aatgctactcttgaatgtggtggtgatcagattggagacaaaggttacttcatccaacct
actgtcttctctaatgttaaggatgacatgcttatcgctcaagacgagattttcggtcca
gtccaatcgatcttgaagttcagtgatgtggatgaggtgataaagagggcgaacgagacg
aagtacgggctagcggcaggggttttcacgaagaatctggacacggcaaacagggtttca
agggctttgaaagctggtaccgtatgggttaactgcttcgacgtatttgatgcagccata
ccatttggtggttacaagatgagtgggaatgggagagagaaaggcatatacagtctcaat
aattacttgcagatcaaggcagtcgtcactgctctaaataagcctgcctggatctga

KEGG   Arabidopsis thaliana (thale cress): AT4G34240
Entry
AT4G34240         CDS       T00041                                 
Symbol
ALDH3I1
Name
(RefSeq) aldehyde dehydrogenase 3I1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00053  Ascorbate and aldarate metabolism
ath00071  Fatty acid degradation
ath00280  Valine, leucine and isoleucine degradation
ath00310  Lysine degradation
ath00330  Arginine and proline metabolism
ath00340  Histidine metabolism
ath00380  Tryptophan metabolism
ath00410  beta-Alanine metabolism
ath00561  Glycerolipid metabolism
ath00620  Pyruvate metabolism
ath00770  Pantothenate and CoA biosynthesis
ath00903  Limonene and pinene degradation
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT4G34240 (ALDH3I1)
   00053 Ascorbate and aldarate metabolism
    AT4G34240 (ALDH3I1)
   00620 Pyruvate metabolism
    AT4G34240 (ALDH3I1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT4G34240 (ALDH3I1)
   00561 Glycerolipid metabolism
    AT4G34240 (ALDH3I1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT4G34240 (ALDH3I1)
   00310 Lysine degradation
    AT4G34240 (ALDH3I1)
   00330 Arginine and proline metabolism
    AT4G34240 (ALDH3I1)
   00340 Histidine metabolism
    AT4G34240 (ALDH3I1)
   00380 Tryptophan metabolism
    AT4G34240 (ALDH3I1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT4G34240 (ALDH3I1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT4G34240 (ALDH3I1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AT4G34240 (ALDH3I1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AT4G34240 (ALDH3I1)
SSDB
Motif
Pfam: Aldedh LuxC DUF1133 YkuI_C
Other DBs
NCBI-GeneID: 829573
NCBI-ProteinID: NP_567962
TAIR: AT4G34240
UniProt: Q8W033 A0A178UV01
LinkDB
Position
4:16389428..16392842
AA seq 550 aa
MTKLLEINHIQTLCFAKGFSPARLNVATSPFRISRRGGGGYCSNACIPYRLKFTCYATLS
AVVKEQASDFSGKEAALLVDELRSNFNSGRTKSYEWRISQLQNIARMIDEKEKCITEALY
QDLSKPELEAFLAEISNTKSSCMLAIKELKNWMAPETVKTSVTTFPSSAQIVSEPLGVVL
VISAWNFPFLLSVEPVIGAIAAGNAVVLKPSEIAPAASSLLAKLFSEYLDNTTIRVIEGG
VPETTALLDQKWDKIFFTGGARVARIIMAAAARNLTPVVLELGGKCPALVDSDVNLQVAA
RRIIAGKWACNSGQACIGVDYVITTKDFASKLIDALKTELETFFGQNALESKDLSRIVNS
FHFKRLESMLKENGVANKIVHGGRITEDKLKISPTILLDVPEASSMMQEEIFGPLLPIIT
VQKIEDGFQVIRSKPKPLAAYLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPFGG
VGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFAAI
LAFFGFSKDS
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgacgaagcttctagagattaatcatattcaaaccctttgttttgccaagggtttttct
cctgccagattaaatgttgcaacttcaccttttcggatatctcgtcgtggtggtggtgga
tattgcagcaatgcttgtatcccttatcggttgaaatttacttgttatgcaacactatct
gctgtggtaaaggagcaagcatcagactttagtggaaaagaagcagctttgcttgtagat
gagctcagaagcaacttcaactctggcagaacgaagagctacgagtggagaatttctcag
cttcaaaacattgctaggatgattgatgagaaggagaaatgcatcaccgaagctttgtat
caagatctttctaagcctgagcttgaagcttttctagctgagatttcgaatacaaaatca
tcctgtatgcttgcaatcaaagagttaaagaactggatggctccagaaacggtcaaaact
tctgtgacaacatttccctcgtctgcacaaatagtctcagaaccgcttggagttgttttg
gttatttcagcctggaatttccctttcttattgtctgtcgagccagtcattggagctatt
gcagctggtaatgcggttgtgctaaaaccttctgaaattgctccagcagcatcttctctt
ttagcaaagttgtttagtgaatacttggacaatacaacaatcagagttatcgagggagga
gtccctgaaacaacggcactactggatcaaaaatgggacaagatctttttcactggtgga
gcaagagttgctcgcattataatggctgcggctgcgagaaatcttactccagtggttctc
gaacttggtgggaagtgcccagctcttgttgattcagatgttaatctacaagtggctgct
aggaggatcattgcagggaaatgggcttgtaacagtggacaggcttgcattggtgttgat
tacgtgatcacaacaaaggattttgcatcaaaattgatagatgctctgaagactgaactg
gagacattttttgggcaaaacgcattagaatcaaaggacctgtcgcggattgtgaactct
ttccacttcaaaaggttggaaagtatgttaaaagagaatggagtagccaacaaaattgtt
catggtggccgaataaccgaagataaacttaaaatatcaccaacaatactactggatgtg
cctgaagcatcttccatgatgcaggaagagatatttggacctttacttcccataattacg
gtacaaaagattgaagatggctttcaggttatacgttcaaagccaaagcctttagcagcg
tatctcttcacaaacaacaaagagttggagaaacaattcgtgcaggacgtatcagcagga
ggaattaccatcaatgacactgtcttacacgtgactgtaaaagatctgccatttggtggg
gttggggagagtgggatcggtgcttaccatgggaaattctcgtatgagacgtttagccat
aagaaaggagttctttaccggagcttttcaggggacgcggatcttagatatcctccttac
acaccaaaaaagaagatggtgcttaaggctttgctctcttcaaacatatttgctgccatt
ttggctttctttgggttctctaaagactcatga

KEGG   Arabidopsis thaliana (thale cress): AT4G36250
Entry
AT4G36250         CDS       T00041                                 
Symbol
ALDH3F1
Name
(RefSeq) aldehyde dehydrogenase 3F1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00053  Ascorbate and aldarate metabolism
ath00071  Fatty acid degradation
ath00280  Valine, leucine and isoleucine degradation
ath00310  Lysine degradation
ath00330  Arginine and proline metabolism
ath00340  Histidine metabolism
ath00380  Tryptophan metabolism
ath00410  beta-Alanine metabolism
ath00561  Glycerolipid metabolism
ath00620  Pyruvate metabolism
ath00770  Pantothenate and CoA biosynthesis
ath00903  Limonene and pinene degradation
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT4G36250 (ALDH3F1)
   00053 Ascorbate and aldarate metabolism
    AT4G36250 (ALDH3F1)
   00620 Pyruvate metabolism
    AT4G36250 (ALDH3F1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT4G36250 (ALDH3F1)
   00561 Glycerolipid metabolism
    AT4G36250 (ALDH3F1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT4G36250 (ALDH3F1)
   00310 Lysine degradation
    AT4G36250 (ALDH3F1)
   00330 Arginine and proline metabolism
    AT4G36250 (ALDH3F1)
   00340 Histidine metabolism
    AT4G36250 (ALDH3F1)
   00380 Tryptophan metabolism
    AT4G36250 (ALDH3F1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT4G36250 (ALDH3F1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT4G36250 (ALDH3F1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AT4G36250 (ALDH3F1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AT4G36250 (ALDH3F1)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 829782
NCBI-ProteinID: NP_195348
TAIR: AT4G36250
UniProt: Q70E96 A4FVT2 A0A384K8S3
LinkDB
Position
4:17150740..17153663
AA seq 484 aa
MEAMKETVEESLREMRETFASGRTRSLKWRKAQIGAIYEMVKDNEDKICNALFQDLGKHS
TEAFRDELGVVLRTATVAINCLDKWAVPKHSKLPLLFYPAKGKVISEPYGTVLVLSSWNF
PISLSLDPLIGAIAAGNTVLLKSSELSPNASAFLAKTIPAYLDTKAIKVIEGGPDVATIL
LQHQWDKIFFTGSPKIGRIIMAAAAQHLTPVTLELGGKCPTIVDHHTISKNIKSVVKRIA
GGKWGSCNGQACISVDYVLIEKSFAPTLIDMLKPTIKSFFGENPKESGCLSRIANKHHVQ
RLSRLLSDPRVQASIVYGGSIDEDKLYVEPTILLDPPLDSEIMNEEIFGPILPIITVRDI
QESIGIINTKPKPLAIYAFTNDENLKTRILSETSSGSVTFNDVMIQYMCDALPFGGVGES
GIGRYHGKYSFDCFSHEKAIMEGSLGMDLEARYPPWNNFKLTFIRLAFREAYFKLILLML
GLKR
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggaagctatgaaggagactgtggaggagagcttgagagagatgagagagacgtttgcg
agtgggaggacgaggagtctgaagtggaggaaggcacagatcggagctatatacgagatg
gttaaagacaacgaagacaagatctgcaatgctctgtttcaagatttgggcaaacacagt
actgaagcttttagagatgagcttggtgttgtcttgcgaacagctactgttgcaatcaac
tgtcttgataaatgggccgtccccaaacatagcaaacttcctctgttgttctacccagca
aaagggaaagtcatatcggaaccctatgggacggttcttgttctgtctagctggaatttt
cctatatctttgtctctggatccattgattggggcaatagcagcaggaaataccgtgctt
ctcaagtcatctgaactaagccctaacgcatctgccttccttgccaagacaattccagct
tatctcgatactaaagccatcaaagttatcgaaggaggacctgatgtcgctactatcctc
ttgcagcatcaatgggacaagatcttcttcaccgggagtcccaagattggaaggatcata
atggctgcagcagcacagcatctgactcctgtgacattggagcttggtggaaaatgtccc
accattgttgatcatcacaccatttcaaagaacatcaagtcggttgtcaagaggattgct
ggaggaaaatggggatcttgcaatggacaagcttgtatctctgtagattacgttcttatc
gaaaagagtttcgcgcctactctgattgatatgttgaagcctacgataaagtctttcttt
ggcgaaaatcctaaagaatctggatgtctctcaaggattgcaaacaagcaccacgttcag
agactgtctcgtcttcttagcgatcctcgtgtccaagcttccatcgtctatggtggttct
atagacgaagataagctgtatgttgagccaacgatcttgttggaccctcctcttgattct
gagatcatgaatgaagagatctttggtccaattctcccgattatcacggtacgtgacatc
caagaaagcatagggatcattaatacaaaaccgaagccacttgccatttatgcattcaca
aatgacgagaaccttaaaactagaattttgtcagaaacatcctcaggaagtgttaccttc
aatgacgtcatgatccagtatatgtgtgatgcgttaccttttggaggagtgggagaaagt
ggaatagggaggtatcacgggaaatactcatttgattgtttcagtcacgagaaagcaata
atggaaggaagcttaggtatggatcttgaagctcgataccctccatggaacaacttcaag
ctcaccttcatcagactcgcatttcgtgaagcttacttcaagcttatcctccttatgctt
ggtcttaaaagataa

DBGET integrated database retrieval system