KEGG   Arabidopsis thaliana (thale cress): AT1G52870
Entry
AT1G52870         CDS       T00041                                 
Name
(RefSeq) Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein
  KO
K13348  protein Mpv17
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT1G52870
SSDB
Motif
Pfam: Mpv17_PMP22 BaffR-Tall_bind
Other DBs
NCBI-GeneID: 841720
NCBI-ProteinID: NP_564615
TAIR: AT1G52870
UniProt: A0A654EHY4 Q9C933
LinkDB
Position
1:19685545..19688028
AA seq 366 aa
MAAASLHTSISPRSFLPLSKPSLKPHRSQILLRNKQRNCVSCALIRDEIDLIPVQSRDRT
DHEEGSVVVMSTETAVDGNESVVVGFSAATSEGQLSLEGFPSSSSSGADLGDEKRRENEE
MEKMIDRTINATIVLAAGSYAITKLLTIDHDYWHGWTLFEILRYAPQHNWIAYEEALKQN
PVLAKMVISGVVYSVGDWIAQCYEGKPLFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEE
LFPFQDWWVVPVKVAFDQTVWSAIWNSIYFTVLGFLRFESPISIFKELKATFLPMLTAGW
KLWPFAHLITYGLVPVEQRLLWVDCVELIWVTILSTYSNEKSEARISESVIETSSSSTTT
IDPSKE
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggctgctgcttcactccacacttcaatctcaccacgtagcttccttcctctctccaaa
ccatctctaaaacctcaccgttcccaaattctactgagaaacaaacagaggaattgcgtt
tcgtgcgcattgatccgtgacgaaatcgacctgattccggttcagagccgagatcggacc
gaccatgaggaaggttcggtggtagtgatgagcactgagacggcggttgatggtaatgaa
tcggttgttgtaggttttagtgctgcgacgagtgaaggtcagctttcgttagaagggttt
ccttcttcttcttcttcgggagctgatttaggagatgaaaagagaagagagaacgaagaa
atggagaagatgatcgatcgaaccattaacgctacgattgttttagctgctggttcttac
gctattaccaaattgcttaccatcgatcatgattattggcatggatggactctgtttgag
atactaagatatgctcctcaacataactggattgcttacgaagaagcgctaaagcaaaac
ccggttctagcaaaaatggtcattagtggagttgtctactctgtaggagattggatagct
cagtgttacgaaggcaaaccgttgtttgaaattgatagagcaagaacattgagatcagga
ctagtaggtttcactctccatggctcgttatcgcatttctattaccagttctgtgaagag
cttttcccgtttcaagattggtgggtggttcctgtgaaagttgcctttgatcaaacagtc
tggtcagctatatggaacagtatttacttcacggttcttggtttcctgcgtttcgaatcg
cctatcagcatcttcaaagaactaaaagctacgttcttgcctatgctaacagcaggttgg
aagctttggccatttgctcatttgatcacatacggtttggtcccagtagaacaacgactt
ctctgggtagattgcgtggagcttatttgggtcactatactttcgacttactcgaacgag
aaatcagaagctagaatctcggaatctgtcattgagacctcttcgagttctactacaacc
attgatccctctaaggaatga

KEGG   Arabidopsis thaliana (thale cress): AT2G14860
Entry
AT2G14860         CDS       T00041                                 
Name
(RefSeq) Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein
  KO
K13348  protein Mpv17
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT2G14860
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 815975
NCBI-ProteinID: NP_179092
TAIR: AT2G14860
UniProt: O82324
LinkDB
Position
2:complement(6387581..6389668)
AA seq 252 aa
MSRALFRNVAVDTARLIRRNAAASTDQYGKTGVAQSRPYFRSRQLLERAKETGVSPSPSL
GFSSSSSPSRIGFVGWYLGMVKSHPVVTKSVTSSLIYIAADLSSQTIAKTSSESYDLVRT
ARMGGYGLFVLGPTLHYWFNFMSRLFPKQDLITTFKKMAMGQTIYGPIMTVIFFSLNASL
QGERGSVILARLKRDLLPALFNGVMYWPLCDFITFRFFPVHLQPLVSNSFSYVWTIYMTY
MANREKPVAIST
NT seq 759 nt   +upstreamnt  +downstreamnt
atgagcagagcattgttcaggaacgtagccgtcgacaccgctcggctcatacggcggaac
gcggcggcgtcaacagaccaatatggtaagaccggagttgctcaatcgagaccttatttc
cggtcacgtcagcttctcgaaagagcaaaagaaacaggagtctcaccttctccttctttg
ggtttctcttcttcttcatctccgtcgaggattgggttcgttggatggtatcttggtatg
gttaaatcacacccagttgtgaccaaaagtgtcacttcctctcttatttacattgccgcc
gacttgtcttctcagacgattgcgaaaacttcttctgagtcttatgacttggtgagaaca
gcaaggatgggaggatatggtttatttgtcttgggtccaacacttcactactggttcaat
ttcatgtcaagactctttcctaaacaagatttgatcacaacgtttaagaaaatggctatg
ggacagacgatctacgggcctattatgactgttattttcttctcattgaatgcatcccta
caaggggaacgcggttcagttatacttgccagattgaaaagggacttactccccgcgctc
tttaacggtgtcatgtattggcctctatgtgattttatcacattcagattcttccctgtt
catttacagcctcttgtaagcaactcattttcgtatgtatggactatctacatgacttac
atggcaaaccgtgaaaaaccagtcgcaatttcaacctga

KEGG   Arabidopsis thaliana (thale cress): AT2G42770
Entry
AT2G42770         CDS       T00041                                 
Name
(RefSeq) Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein
  KO
K13348  protein Mpv17
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT2G42770
SSDB
Motif
Pfam: Mpv17_PMP22 TMEM37
Other DBs
NCBI-GeneID: 818877
NCBI-ProteinID: NP_565983
TAIR: AT2G42770
UniProt: A0A178VTI1 Q9SJH9
LinkDB
Position
2:complement(17798266..17800072)
AA seq 232 aa
MDALGGCGGAGGFWGWNGFDQRRKKKSSGDRGKKRNSGSSDSVDVSRDAGGYRFPLKQAV
TAGALTFTGDTIAQLSGRWKKRTALKQSSSELDEGELWNIFSEHDWIRALRMSSYGFLLY
GPGSYAWYQFLDHSLPKPTATNLVLKVLLNQVILGPSVIAVIFAWNNLWLGKLSELGNKY
QKDALPTLLYGFRFWVPVSILNFWVVPLQARVAFMSMGSVFWNFYLSSTMSK
NT seq 699 nt   +upstreamnt  +downstreamnt
atggacgcattgggtggttgcggcggcgctggtggtttctggggatggaatggcttcgat
caacggagaaagaagaagtcttccggtgatagaggtaagaaacgtaattctggatcgtcg
gattccgtcgatgtgagcagagacgccggcggttatcggtttcctttgaagcaagctgtg
acggccggagcactcactttcaccggtgacacgattgctcagctatcagggagatggaaa
aagagaaccgctcttaaacaatcatcttctgagcttgacgagggggaattgtggaacatt
ttctcagaacatgactggattcgtgcgctgcggatgagttcttacgggtttctcttgtat
ggtcctggttcttatgcgtggtaccaattccttgatcattctttgcctaaaccaactgcg
acaaatctagtgcttaaggttctgcttaaccaagtaatccttggtccatctgtgattgct
gttatatttgcttggaacaacttgtggctgggaaagctctctgagcttggaaacaagtat
cagaaagatgctcttcctacgcttctttatggatttcgcttctgggttcccgttagcata
cttaacttttgggtagtcccgcttcaagctcgagtagcgttcatgtccatgggttctgtg
ttttggaacttctacttatcttcaactatgagcaagtag

KEGG   Arabidopsis thaliana (thale cress): AT3G24570
Entry
AT3G24570         CDS       T00041                                 
Name
(RefSeq) Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein
  KO
K13348  protein Mpv17
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G24570
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 822053
NCBI-ProteinID: NP_001189964
TAIR: AT3G24570
UniProt: F4J7Q0
LinkDB
Position
3:complement(8966521..8968676)
AA seq 222 aa
MLKLWRWYQRCLTVHPVKTQVISSGFLWGFGDVTAQYITHSTAKRRLLRLTETNKDADAD
AEIKVKWKQDAEFKVNWKRVAITSMYEGLDKFIKLKLRYVPKSTRFVAAKVAMDGLIFGP
VDLLVFFTYMGFATGKNTAEVKEGLKRDFLPALALEGGAWPLLQIANFRYVPVQYQLLYV
NIFCLVDSAFLSWVEQQKDAAWKQWFTSSFQPLKERGGQGGV
NT seq 669 nt   +upstreamnt  +downstreamnt
atgttgaagctttggagatggtaccagcgatgcctgacggttcatcctgtgaaaactcag
gtcatcagttctggatttctttggggatttggcgatgtcaccgctcaatacatcactcat
tccactgcgaaacgtcgtcttcttcgtctcaccgaaacaaataaagatgctgacgcagat
gcagaaattaaggtcaagtggaagcaagatgcagaattcaaagtcaactggaagcgagta
gctatcacgagcatgtacgaaggcttggataaattcataaaactgaagcttcgatatgta
ccaaagtcaacacgttttgtagctgcaaaagttgcaatggatggtcttatctttggacct
gtagatctactggtgttcttcacatacatgggattcgccacaggaaagaacacagctgaa
gtgaaagaaggactcaagagagattttcttccggctctagctcttgaaggcggagcatgg
ccacttcttcagattgcaaacttcagatatgttcccgtgcaataccagttgctttacgtc
aacatcttttgcctagtagacagtgccttcctctcatgggtcgagcaacagaaggacgca
gcttggaagcaatggtttacttcatcatttcaaccattaaaagaacgaggtggccaaggc
ggagtatga

KEGG   Arabidopsis thaliana (thale cress): AT4G03410
Entry
AT4G03410         CDS       T00041                                 
Name
(RefSeq) Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein
  KO
K13348  protein Mpv17
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT4G03410
SSDB
Motif
Pfam: Mpv17_PMP22 NnrU
Other DBs
NCBI-GeneID: 827932
NCBI-ProteinID: NP_192250
TAIR: AT4G03410
UniProt: Q5XEV3
LinkDB
Position
4:1501168..1503699
AA seq 317 aa
MAALCCCPTTIIVSGKVSSRIKTAGPLPRINPFKNQKRLITERRNLIVKSIIEDREAIDV
KNDNFKAEEELSEDKVEDTDRLMSRGINAAIVLAAGTVAVTKLLTIDHDYWQGWTLYEIL
RYAPEHNWFAYEQILKTNPVLAKMAISGIVYSLGDWIAQCYEGKPLFEFDRTRVLRSGLV
GFTLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTVWSAIWNSIYFTVLGLLRFQSPA
DIFSEIKTTFLPMLTAGWKLWPLAHLVTYGVIPVDQRLLWVDCIELIWVTILSTYSNEKA
EAQASEETNSSSHSSED
NT seq 954 nt   +upstreamnt  +downstreamnt
atggcagctctctgttgttgtcccaccaccatcatcgtctccgggaaggtttcttcacgg
attaaaaccgcaggcccattaccccgaatcaacccttttaagaatcagaaacgattgatt
acagagagaagaaacttgatcgttaaatcgatcattgaagacagagaagcaatcgatgtt
aaaaatgacaatttcaaggcagaggaagaactatcagaagataaagtagaagatacagat
cggctgatgagtcgaggtatcaacgcagctatagttctcgccgccggtaccgttgcggtt
actaagcttttaaccattgatcatgactattggcaaggttggactctctacgagatactt
aggtatgcacctgaacataattggtttgcgtatgaacaaattctcaaaacaaaccctgtt
ttggcgaaaatggcgattagtggaattgtgtattctttaggagattggattgcacaatgt
tacgaaggaaaaccgctgtttgagtttgatcgaactcgtgttcttagatcaggtcttgtt
ggattcacactccatggttcactgtctcactattactaccaattctgtgaggctctcttt
ccttttcaagaatggtgggtagtccctgcaaaagtcgcatttgatcaaaccgtatggtct
gcaatttggaacagtatctactttacagttttagggctcttgcgtttccaatctccagct
gacattttcagcgaaatcaagacaacatttttgccaatgctcactgcaggctggaaactc
tggccattggcacacttggttacatacggtgtaatccctgtagaccaaaggcttctttgg
gtagattgtattgaactcatatgggtcactatattatcaacttactcgaacgaaaaagct
gaggcgcaagcatcagaggaaacgaactccagttctcactcaagcgaggattag

KEGG   Arabidopsis thaliana (thale cress): AT4G33905
Entry
AT4G33905         CDS       T00041                                 
Name
(RefSeq) Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein
  KO
K13348  protein Mpv17
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT4G33905
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 829534
NCBI-ProteinID: NP_567940
TAIR: AT4G33905
UniProt: Q9FPH4 A0A654FVC1
LinkDB
Position
4:complement(16253752..16255760)
AA seq 261 aa
MTGALFRNAASDAARIFRLQRATMTNPFGKLDPLPIGGNIQRLQSRPFYRTPQFLGKAKE
TGVSGFCSSSSSSSSTVSTAGFIGWYLGMVKSRPVLTKSVTSSLIYIAADLSSQTIPQAS
VDSYDLVRTARMGGYGLLILGPTLHYWFNLMSSLFPKRDLITTFKKMAMGQTVYGPAMNV
VFFSLNAALQGENGSEIVARLKRDLLPTMLNGVMYWPLCDFITFKFCPVYLQPLVSNSFS
YLWTIYITYMASRATPTAIEI
NT seq 786 nt   +upstreamnt  +downstreamnt
atgaccggcgcattgtttagaaacgctgcttccgacgccgctcggatctttcgattacag
cgagcaacgatgacgaatccttttggaaagctcgaccctttaccgataggaggaaacatc
cagcgattgcagtcgaggcctttttatcgtacgcctcagtttctcgggaaagcaaaggaa
acaggtgtctctggtttctgttcgtcttcgtcttcgtcttcttcgacggtctctacagca
ggattcatcggatggtatttgggaatggtgaaatctcggccggttcttaccaaatccgtc
acgtcctcgcttatttacatagcagccgatttgtcttcgcagacaattccacaagcttca
gtggattcttatgacttggtaagaacagcaaggatgggaggatatgggttattaatcttg
ggtcctacacttcactattggttcaatctcatgtcaagtctcttcccaaaacgagatttg
atcacaacgtttaagaaaatggccatgggacagacagtctatgggcctgccatgaatgtt
gttttcttctcactgaatgcagccctacagggtgaaaatggttcagagatagttgctaga
ttgaaaagggacctacttcccacaatgcttaatggtgtcatgtattggcctttgtgtgat
tttattactttcaagttctgccctgtttatttacagccacttgtgagcaactcgttttcg
tatctatggacaatctacataacttatatggcaagccgtgcgacgccaaccgccattgaa
atttga

KEGG   Arabidopsis thaliana (thale cress): AT5G19750
Entry
AT5G19750         CDS       T00041                                 
Name
(RefSeq) Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein
  KO
K13348  protein Mpv17
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT5G19750
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 832095
NCBI-ProteinID: NP_197476
TAIR: AT5G19750
UniProt: A0A654G381 F4K2L8
LinkDB
Position
5:6677016..6679384
AA seq 288 aa
MLNSITLTRKPPLPFNSVGFSGNHSSSFGRRTITEGSSSKALSFGYKNVGSLKCGRSNWP
GRSGTAFGHLVRVSAVPGGNSGGSGGLGGSGGGGGGSGGGGGDGSDGKGKKWSLLSWYQA
LLSNSPVLTKAVTAALLNLVGDLICQLTINKTSSLDKKRTLTFTFLGLGLVGPTLHFWYL
YLSKVVTASGLSGAVIRLLLDQFVFAPIFVGVFLSAVVTLEGKPSNVIPKLQQEWTGAMI
ANWQLWIPFQFLNFRFVPQNYQVLASNVVALAWNVILSFKAHKEVVAK
NT seq 867 nt   +upstreamnt  +downstreamnt
atgcttaactctatcactttaacccggaaaccaccactcccgttcaactctgttgggttt
tcaggtaatcactcttcgtcttttggtcgaagaactataacggaaggtagttcgagcaag
gctctttcgtttgggtacaaaaatgttggttcactgaagtgtggtcggagcaattggccg
gggcgttctgggactgcgtttgggcatctagtccgggtctctgcggtcccaggtgggaat
tcaggtggctctggcgggttaggtggttcaggcggtggtggtggtggttccggcggcggt
ggtggtgatggaagcgacggaaaaggaaagaagtggtcacttctctcatggtaccaggct
cttctctcaaactctcctgttttgaccaaagctgtgaccgcagcacttttgaacctcgtt
ggagatttgatctgtcagcttactatcaacaagacctcatcgctggacaagaagaggaca
ctcacctttaccttcttgggcttagggctagtcggtccaacattgcatttctggtatttg
tatttgagcaaagtggtgacagcttctggattatcaggcgcagttatacgacttctactg
gatcagtttgtttttgctcctatttttgttggagttttcttatcagcagttgtgacactt
gaaggaaaaccatcaaatgtcataccgaagctacaacaggagtggactggtgcaatgata
gcaaattggcagctatggataccatttcagtttcttaacttcagatttgttccacagaac
taccaggtacttgcttcaaacgtagtggctttggcttggaatgtgattttatcattcaaa
gctcacaaagaagttgttgcaaagtag

KEGG   Arabidopsis thaliana (thale cress): AT5G43140
Entry
AT5G43140         CDS       T00041                                 
Name
(RefSeq) Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein
  KO
K13348  protein Mpv17
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT5G43140
SSDB
Other DBs
NCBI-GeneID: 834331
NCBI-ProteinID: NP_001332318
TAIR: AT5G43140
UniProt: A0A1P8BGJ9
LinkDB
Position
5:17321395..17323484
AA seq 188 aa
MNIVGLSKRFFSDRRSLHGINNALLKTVFTGRKPILGFSGRSIHELRKTGNFVIPRVFSV
SRNLTTKASSSSSKQPAFLRWYLRKLESHPFMTKSITTSVIYMAADLTSQMITMEPTGSF
DLIRTARMASFGLIFLGPSQHLWFSYLSKILPKRDVLTTFKKIMMGQVLFGPVSNTVFYS
YNAALQGT
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaatatcgttggattgagcaaacgtttcttctccgatcgtcgctctcttcacgggatc
aacaatgctctcttgaaaacagtgttcaccggtcggaaaccgattctcggattctccggc
cgatcgattcacgagctacgcaaaactgggaatttcgtaatccctcgtgttttctccgtg
tcgcgaaatctaacgacgaaggcttcgtcttcttcttcgaaacaacctgcgtttctacga
tggtatttgagaaagctcgaatcacatccttttatgactaagagtatcactacttctgtc
atctatatggctgcagatctcacttctcagatgatcacaatggagccaactggttctttt
gacttgataagaacagcgagaatggcgagctttgggttgatatttctcgggccgtctcag
catctgtggttcagttatctttcgaagatattgccaaagcgcgacgtgttgacaaccttt
aagaaaataatgatggggcaggttcttttcggacctgttagcaacacagtcttctattcc
tacaatgctgctttacaaggtacataa

DBGET integrated database retrieval system