Arabidopsis thaliana (thale cress): AT1G54210 Help Entry AT1G54210         CDS       T00041                                  Symbol ATG12A Name (RefSeq) Ubiquitin-like superfamily protein   KO K08336   ubiquitin-like protein ATG12 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath04136   Autophagy - other Brite KEGG Orthology (KO) [BR:ath00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     AT1G54210 (ATG12A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ath04131]     AT1G54210 (ATG12A)    04121 Ubiquitin system [BR:ath04121]     AT1G54210 (ATG12A)    03029 Mitochondrial biogenesis [BR:ath03029]     AT1G54210 (ATG12A) Membrane trafficking [BR:ath04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     AT1G54210 (ATG12A) Ubiquitin system [BR:ath04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    AT1G54210 (ATG12A) Mitochondrial biogenesis [BR:ath03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     AT1G54210 (ATG12A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 DUF4264 Motif Other DBs NCBI-GeneID:  841861 NCBI-ProteinID:  NP_001320241 TAIR:  AT1G54210 UniProt:  Q8S924 A0A178VZU7 LinkDB All DBs Position 1:20241226..20242641 Genome browser AA seq 96 aa AA seqDB search MATESSSPSSVRKVVVHLRATGGAPILKQSKFKIPGTDKFAKVIDFLRRQLHSDSLFVYV NSAFSPNPDESVIDLYNNFGFDGKLVVNYACSMAWG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgacggagtcgtcgtccccgagctctgttcggaaagttgttgttcatctaagagct actggaggtgctcctatactcaaacaatctaagttcaagattccagggactgataaattt gccaaagtgattgactttcttagaagacagcttcattctgattcgttgtttgtctatgtg aatagtgctttctcgccaaaccctgatgaatcagtcattgatctttataataactttgga tttgatggtaaactggtggttaactatgcttgttccatggcatggggctaa

Arabidopsis thaliana (thale cress): AT3G13970 Help Entry AT3G13970         CDS       T00041                                  Symbol APG12B Name (RefSeq) Ubiquitin-like superfamily protein   KO K08336   ubiquitin-like protein ATG12 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath04136   Autophagy - other Brite KEGG Orthology (KO) [BR:ath00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     AT3G13970 (APG12B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ath04131]     AT3G13970 (APG12B)    04121 Ubiquitin system [BR:ath04121]     AT3G13970 (APG12B)    03029 Mitochondrial biogenesis [BR:ath03029]     AT3G13970 (APG12B) Membrane trafficking [BR:ath04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     AT3G13970 (APG12B) Ubiquitin system [BR:ath04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    AT3G13970 (APG12B) Mitochondrial biogenesis [BR:ath03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     AT3G13970 (APG12B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  820611 NCBI-ProteinID:  NP_188013 TAIR:  AT3G13970 UniProt:  Q9LVK3 A0A178VDM5 Structure PDB LinkDB All DBs Position 3:complement(4613492..4614857) Genome browser AA seq 94 aa AA seqDB search MATESPNSVQKIVVHLRATGGAPILKQSKFKVSGSDKFANVIDFLRRQLHSDSLFVYVNS AFSPNPDESVIDLYNNFGFDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcgaccgaatctccgaattctgttcagaaaattgttgttcatctgcgagctactggt ggtgctccgatactgaaacaatctaaattcaaggtttcagggagtgacaagtttgctaac gtgattgattttctaagacggcagcttcactctgactcattgtttgtttatgtgaacagc gctttctcgccaaacccggatgaatcagtaattgatctatacaataactttgggtttgat ggtaaactggtggtgaactatgcttgttccatggcatggggttaa

DBGET integrated database retrieval system