KEGG   Arabidopsis thaliana (thale cress): AT1G54210
Entry
AT1G54210         CDS       T00041                                 
Symbol
ATG12A
Name
(RefSeq) Ubiquitin-like superfamily protein
  KO
K08336  ubiquitin-like protein ATG12
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT1G54210 (ATG12A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT1G54210 (ATG12A)
   04121 Ubiquitin system [BR:ath04121]
    AT1G54210 (ATG12A)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT1G54210 (ATG12A)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    AT1G54210 (ATG12A)
Ubiquitin system [BR:ath04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   AT1G54210 (ATG12A)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT1G54210 (ATG12A)
SSDB
Motif
Pfam: APG12 ATG8 DUF4264
Other DBs
NCBI-GeneID: 841861
NCBI-ProteinID: NP_001320241
TAIR: AT1G54210
UniProt: Q8S924 A0A178VZU7
LinkDB
Position
1:20241226..20242641
AA seq 96 aa
MATESSSPSSVRKVVVHLRATGGAPILKQSKFKIPGTDKFAKVIDFLRRQLHSDSLFVYV
NSAFSPNPDESVIDLYNNFGFDGKLVVNYACSMAWG
NT seq 291 nt   +upstreamnt  +downstreamnt
atggcgacggagtcgtcgtccccgagctctgttcggaaagttgttgttcatctaagagct
actggaggtgctcctatactcaaacaatctaagttcaagattccagggactgataaattt
gccaaagtgattgactttcttagaagacagcttcattctgattcgttgtttgtctatgtg
aatagtgctttctcgccaaaccctgatgaatcagtcattgatctttataataactttgga
tttgatggtaaactggtggttaactatgcttgttccatggcatggggctaa

KEGG   Arabidopsis thaliana (thale cress): AT3G13970
Entry
AT3G13970         CDS       T00041                                 
Symbol
APG12B
Name
(RefSeq) Ubiquitin-like superfamily protein
  KO
K08336  ubiquitin-like protein ATG12
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT3G13970 (APG12B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G13970 (APG12B)
   04121 Ubiquitin system [BR:ath04121]
    AT3G13970 (APG12B)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT3G13970 (APG12B)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    AT3G13970 (APG12B)
Ubiquitin system [BR:ath04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   AT3G13970 (APG12B)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT3G13970 (APG12B)
SSDB
Motif
Pfam: APG12 ATG8
Other DBs
NCBI-GeneID: 820611
NCBI-ProteinID: NP_188013
TAIR: AT3G13970
UniProt: Q9LVK3 A0A178VDM5
Structure
LinkDB
Position
3:complement(4613492..4614857)
AA seq 94 aa
MATESPNSVQKIVVHLRATGGAPILKQSKFKVSGSDKFANVIDFLRRQLHSDSLFVYVNS
AFSPNPDESVIDLYNNFGFDGKLVVNYACSMAWG
NT seq 285 nt   +upstreamnt  +downstreamnt
atggcgaccgaatctccgaattctgttcagaaaattgttgttcatctgcgagctactggt
ggtgctccgatactgaaacaatctaaattcaaggtttcagggagtgacaagtttgctaac
gtgattgattttctaagacggcagcttcactctgactcattgtttgtttatgtgaacagc
gctttctcgccaaacccggatgaatcagtaattgatctatacaataactttgggtttgat
ggtaaactggtggtgaactatgcttgttccatggcatggggttaa

DBGET integrated database retrieval system