KEGG   Arabidopsis thaliana (thale cress): AT1G62040
Entry
AT1G62040         CDS       T00041                                 
Symbol
ATG8C
Name
(RefSeq) Ubiquitin-like superfamily protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT1G62040 (ATG8C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT1G62040 (ATG8C)
   04121 Ubiquitin system [BR:ath04121]
    AT1G62040 (ATG8C)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT1G62040 (ATG8C)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    AT1G62040 (ATG8C)
Ubiquitin system [BR:ath04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   AT1G62040 (ATG8C)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT1G62040 (ATG8C)
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 842499
NCBI-ProteinID: NP_176395
TAIR: AT1G62040
UniProt: Q8S927 A0A178W309
LinkDB
Position
1:22932760..22934549
AA seq 119 aa
MANSSFKLEHPLERRQIESSRIREKYPDRIPVIVERAERSDVPNIDKKKYLVPADLTVGQ
FVYVVRKRIKLSAEKAIFVFVKNTLPPTAAMMSAIYDENKDEDGFLYMTYSGENTFGLV
NT seq 360 nt   +upstreamnt  +downstreamnt
atggctaatagctctttcaagttggaacacccactagagaggagacaaattgaatcttct
cgcatcagggagaagtatccagacagaattccagtgatcgtagagagagctgaaagaagt
gatgttcccaatatcgacaagaagaagtaccttgttccagctgatctaactgttgggcaa
tttgtgtatgttgtccgtaaaagaatcaagctgagtgccgaaaaggctatcttcgtcttt
gtgaagaacacattgcctccaactgctgcaatgatgtctgcaatctatgatgagaacaaa
gacgaagatgggtttctctacatgacttacagtggagagaacacctttggtttggtttaa

KEGG   Arabidopsis thaliana (thale cress): AT2G05630
Entry
AT2G05630         CDS       T00041                                 
Symbol
ATG8D
Name
(RefSeq) Ubiquitin-like superfamily protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT2G05630 (ATG8D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT2G05630 (ATG8D)
   04121 Ubiquitin system [BR:ath04121]
    AT2G05630 (ATG8D)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT2G05630 (ATG8D)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    AT2G05630 (ATG8D)
Ubiquitin system [BR:ath04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   AT2G05630 (ATG8D)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT2G05630 (ATG8D)
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 815112
NCBI-ProteinID: NP_178631
TAIR: AT2G05630
UniProt: Q9SL04 A0A178VRR4
LinkDB
Position
2:complement(2082894..2084905)
AA seq 120 aa
MAISSFKHEHPLEKRQAEAARIREKYPDRIPVIVERAEKSDVPDIDRKKYLVPADLTVGQ
FVYVVRKRIKLSPEKAIFIFVKNILPPTAAIMSAIYEEHKDEDGFLYMSYSGENTFGIFF
NT seq 363 nt   +upstreamnt  +downstreamnt
atggcgattagctccttcaagcatgaacatcctcttgaaaagagacaagctgaagcagca
cgtatcagggagaagtatccagacagaataccagtcattgtcgaaagagccgagaagagt
gatgtcccggatattgataggaaaaagtacttggtcccagctgatttgactgttggccag
tttgtttatgttgtacggaagcggatcaagctcagtcccgagaaagccatcttcattttt
gtcaagaacattctaccaccaactgcggcaataatgtctgcaatttatgaagagcacaaa
gacgaagacgggtttctatacatgagttacagtggtgagaacacgttcgggatcttcttc
taa

KEGG   Arabidopsis thaliana (thale cress): AT2G45170
Entry
AT2G45170         CDS       T00041                                 
Symbol
ATG8E
Name
(RefSeq) AUTOPHAGY 8E
  KO
K08341  GABA(A) receptor-associated protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT2G45170 (ATG8E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT2G45170 (ATG8E)
   04121 Ubiquitin system [BR:ath04121]
    AT2G45170 (ATG8E)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT2G45170 (ATG8E)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    AT2G45170 (ATG8E)
Ubiquitin system [BR:ath04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   AT2G45170 (ATG8E)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT2G45170 (ATG8E)
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 819125
NCBI-ProteinID: NP_182042
TAIR: AT2G45170
UniProt: Q8S926 A0A178VZA0
LinkDB
Position
2:18624264..18625791
AA seq 122 aa
MNKGSIFKMDNDFEKRKAEAGRIREKYPDRIPVIVEKAEKSEVPNIDKKKYLVPSDLTVG
QFVYVIRKRIKLSAEKAIFIFVDNVLPPTGELMSSVYEDKKDEDGFLYITYSGENTFGAS
SI
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaataaaggaagcatctttaagatggacaacgatttcgaaaagagaaaagctgaagct
ggaaggatcagggagaaataccctgatcgaattcctgtgattgtggaaaaggctgagaaa
agtgaagtcccaaatatagacaagaagaagtaccttgtgccatcagacctaacagttggt
caatttgtgtatgtgattcggaagagaatcaaactaagtgcagagaaagctatcttcatt
ttcgtagacaatgttcttcctccaacaggagagctaatgtcaagcgtttacgaggataag
aaagacgaagatggcttcctttacatcacttacagtggcgagaacacattcggtgcttct
tcaatctaa

KEGG   Arabidopsis thaliana (thale cress): AT3G06420
Entry
AT3G06420         CDS       T00041                                 
Symbol
ATG8H
Name
(RefSeq) Ubiquitin-like superfamily protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT3G06420 (ATG8H)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G06420 (ATG8H)
   04121 Ubiquitin system [BR:ath04121]
    AT3G06420 (ATG8H)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT3G06420 (ATG8H)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    AT3G06420 (ATG8H)
Ubiquitin system [BR:ath04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   AT3G06420 (ATG8H)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT3G06420 (ATG8H)
SSDB
Motif
Pfam: ATG8 APG12 APG5
Other DBs
NCBI-GeneID: 819816
NCBI-ProteinID: NP_566283
TAIR: AT3G06420
UniProt: Q8S925 A0A5S9X9N9
LinkDB
Position
3:complement(1954990..1956397)
AA seq 119 aa
MGIVVKSFKDQFSSDERLKESNNIIAKYPDRIPVIIEKYSNADLPDMEKNKYLVPRDMTV
GHFIHMLSKRMQLDPSKALFVFVHNTLPQTASRMDSLYNTFKEEDGFLYMCYSTEKTFG
NT seq 360 nt   +upstreamnt  +downstreamnt
atggggattgttgtcaagtctttcaaggatcaattctcctctgatgagagattgaaggag
tcgaacaacatcattgcgaaatatccagatagaatacctgtgatcattgagaaatattca
aacgcagatctgccagacatggagaagaacaaatacttggtcccacgagacatgactgtt
ggacatttcatccatatgctaagcaaaaggatgcagttagatccatccaaagctctcttt
gttttcgtacacaacactcttcctcaaaccgctagtcgcatggactctctctacaatact
ttcaaggaagaagacgggttcttgtacatgtgctacagcaccgagaaaactttcggctaa

KEGG   Arabidopsis thaliana (thale cress): AT3G15580
Entry
AT3G15580         CDS       T00041                                 
Symbol
APG8H
Name
(RefSeq) Ubiquitin-like superfamily protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT3G15580 (APG8H)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G15580 (APG8H)
   04121 Ubiquitin system [BR:ath04121]
    AT3G15580 (APG8H)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT3G15580 (APG8H)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    AT3G15580 (APG8H)
Ubiquitin system [BR:ath04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   AT3G15580 (APG8H)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT3G15580 (APG8H)
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 820798
NCBI-ProteinID: NP_566518
TAIR: AT3G15580
UniProt: Q9LRP7 A0A178VBL7
LinkDB
Position
3:complement(5273526..5275095)
AA seq 115 aa
MKSFKEQYTLDERLAESREIIAKYPTRIPVIAEKYCKTDLPAIEKKKFLVPRDMSVGQFI
YILSARLHLSPGKALFVFVNNTLPQTAALMDSVYESYKDDDGFVYMCYSSEKTFG
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaaatcgttcaaggaacaatacacgttggatgaaaggctcgcggagtcgcgggagata
atcgctaagtaccctactcggattccagtaattgctgagaagtattgcaaaacggatctg
cctgccatcgagaaaaagaagtttctggttccaagagatatgtcagttggccaattcatc
tacatattgagtgctaggttacatttgtctcctggtaaagccttattcgtgtttgtcaac
aacactctccctcaaactgctgctctgatggactcggtctacgaatcttacaaagatgat
gatggattcgtttacatgtgctatagcagtgagaaaacctttggttga

KEGG   Arabidopsis thaliana (thale cress): AT3G60640
Entry
AT3G60640         CDS       T00041                                 
Symbol
ATG8G
Name
(RefSeq) Ubiquitin-like superfamily protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT3G60640 (ATG8G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G60640 (ATG8G)
   04121 Ubiquitin system [BR:ath04121]
    AT3G60640 (ATG8G)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT3G60640 (ATG8G)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    AT3G60640 (ATG8G)
Ubiquitin system [BR:ath04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   AT3G60640 (ATG8G)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT3G60640 (ATG8G)
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 825235
NCBI-ProteinID: NP_191623
TAIR: AT3G60640
UniProt: Q9LZZ9 A0A178VL35
LinkDB
Position
3:22415751..22417548
AA seq 121 aa
MSNVSFRQDHDFEKRKAEALRIREKYSDRVPVIVEKSEKSDIPNIDKKKYLVPADLTVGQ
FVYVIRKRIQLSAEKAIFIFVDNVLPPTGAMMSTIYDENKEEDGFLYVTYSGENTFGSSM
T
NT seq 366 nt   +upstreamnt  +downstreamnt
atgagtaacgtcagcttcaggcaggatcatgatttcgagaagaggaaagctgaggcttta
aggatcagagagaagtattctgacagagtcccggtgattgtggagaagtcagagaaaagt
gatatcccaaacattgacaagaagaaataccttgtcccagctgatctaacggtaggccag
tttgtgtatgtgattcgtaagagaatccaacttagtgcagagaaagctatcttcatcttt
gttgataatgttcttcctcccaccggagcgatgatgtcaaccatttacgatgagaataag
gaagaagacggcttcttgtatgttacctacagtggggaaaacacttttggatcgtcaatg
acttaa

KEGG   Arabidopsis thaliana (thale cress): AT4G04620
Entry
AT4G04620         CDS       T00041                                 
Symbol
ATG8B
Name
(RefSeq) Ubiquitin-like superfamily protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT4G04620 (ATG8B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT4G04620 (ATG8B)
   04121 Ubiquitin system [BR:ath04121]
    AT4G04620 (ATG8B)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT4G04620 (ATG8B)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    AT4G04620 (ATG8B)
Ubiquitin system [BR:ath04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   AT4G04620 (ATG8B)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT4G04620 (ATG8B)
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 825794
NCBI-ProteinID: NP_001329707
TAIR: AT4G04620
UniProt: Q9XEB5 A0A178V3P6
LinkDB
Position
4:complement(2328442..2330590)
AA seq 122 aa
MEKNSFKLSNPLEMRMAESTRIRAKYPERVPVIVEKAGQSDVPDIDKKKYLVPADLTIGQ
FVYVVRKRIKLGAEKAIFVFVKNTLPPTAALMSAIYEEHKDEDGFLYMTYSGENTFGGSF
YC
NT seq 369 nt   +upstreamnt  +downstreamnt
atggagaagaactccttcaagctttctaatcctctggagatgagaatggctgagtctact
cgtatcagagcgaaataccctgaaagagttcccgtgattgtggaaaaagctggacagagt
gatgttcctgacattgacaagaagaagtatcttgtaccagctgatctaaccattggccaa
tttgtgtacgttgtgaggaaaagaatcaagcttggagctgaaaaagccatctttgtcttt
gtcaagaacacattaccaccaactgcggcattgatgtctgcaatctacgaagaacacaaa
gacgaagacgggtttctctacatgacatacagtggagagaacacatttggtggatctttc
tactgctaa

KEGG   Arabidopsis thaliana (thale cress): AT4G16520
Entry
AT4G16520         CDS       T00041                                 
Symbol
ATG8F
Name
(RefSeq) Ubiquitin-like superfamily protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT4G16520 (ATG8F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT4G16520 (ATG8F)
   04121 Ubiquitin system [BR:ath04121]
    AT4G16520 (ATG8F)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT4G16520 (ATG8F)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    AT4G16520 (ATG8F)
Ubiquitin system [BR:ath04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   AT4G16520 (ATG8F)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT4G16520 (ATG8F)
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 827351
NCBI-ProteinID: NP_567504
TAIR: AT4G16520
UniProt: Q8VYK7
Structure
LinkDB
Position
4:complement(9306339..9308538)
AA seq 121 aa
MAKSSFKQEHDLEKRRAEAARIREKYPDRIPVIVEKAEKSDIPTIDKKKYLVPADLTVGQ
FVYVIRKRIKLSAEKAIFIFVDNVLPPAGALMSSVYEEKKDDDGFLYVTYSGENTFGFGS
P
NT seq 366 nt   +upstreamnt  +downstreamnt
atggcaaaaagctcgttcaagcaagagcatgacttagagaagagaagggcagaggctgct
aggattagagagaagtatcctgataggattccggtgattgttgagaaggctgagaagagt
gatataccaaccatcgacaagaaaaagtacctagtcccggctgatctgactgtggggcag
tttgtgtatgtcattcgcaaaagaatcaaattgagtgcagaaaaggctatcttcatattc
gtggacaatgttcttcctccagcaggtgcgctcatgtcttctgtgtacgaagagaaaaag
gatgatgatgggttcctctatgtcacttacagcggagaaaacacatttggatttggatct
ccataa

KEGG   Arabidopsis thaliana (thale cress): AT4G21980
Entry
AT4G21980         CDS       T00041                                 
Symbol
APG8A
Name
(RefSeq) Ubiquitin-like superfamily protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    AT4G21980 (APG8A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT4G21980 (APG8A)
   04121 Ubiquitin system [BR:ath04121]
    AT4G21980 (APG8A)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT4G21980 (APG8A)
Membrane trafficking [BR:ath04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    AT4G21980 (APG8A)
Ubiquitin system [BR:ath04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   AT4G21980 (APG8A)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AT4G21980 (APG8A)
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 828287
NCBI-ProteinID: NP_567642
TAIR: AT4G21980
UniProt: Q8LEM4 A0A178UVA3
LinkDB
Position
4:11655562..11657034
AA seq 122 aa
MAKSSFKISNPLEARMSESSRIREKYPDRIPVIVEKAGQSDVPDIDKKKYLVPADLTVGQ
FVYVVRKRIKLGAEKAIFVFVKNTLPPTAALMSAIYEEHKDEDGFLYMTYSGENTFGSLT
VA
NT seq 369 nt   +upstreamnt  +downstreamnt
atggctaagagttccttcaagatctctaaccctctcgaggcaaggatgagtgaatcttct
cgaatcagagagaagtaccctgacagaattcccgtgattgtggagaaggctggacaaagt
gatgttcctgacattgacaagaagaagtatcttgtaccagctgatctaacagtgggacaa
tttgtatacgtggttcgtaaaagaatcaagcttggagctgagaaagctatttttgtcttt
gttaagaacacattgcctccaactgctgcattgatgtctgcgatctatgaagaacacaaa
gatgaggatgggttcctctacatgacttacagtggagagaacacttttggatctcttacc
gttgcttga

DBGET integrated database retrieval system