KEGG   Arabidopsis thaliana (thale cress): AT1G65480
Entry
AT1G65480         CDS       T00041                                 

Symbol
FT
Name
(RefSeq) PEBP (phosphatidylethanolamine-binding protein) family protein
  KO
K16223  protein FLOWERING LOCUS T
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT1G65480 (FT)
SSDB
Motif
Pfam: PBP
Other DBs
NCBI-GeneID: 842859
NCBI-ProteinID: NP_176726
TAIR: AT1G65480
UniProt: Q9SXZ2 A0A178WM09
LinkDB
Structure
PDB: 
1WKP

Position
1:24331373..24333999
AA seq 175 aa
MSINIRDPLIVSRVVGDVLDPFNRSITLKVTYGQREVTNGLDLRPSQVQNKPRVEIGGED
LRNFYTLVMVDPDVPSPSNPHLREYLHWLVTDIPATTGTTFGNEIVCYENPSPTAGIHRV
VFILFRQLGRQTVYAPGWRQNFNTREFAEIYNLGLPVAAVFYNCQRESGCGGRRL
NT seq 528 nt   +upstreamnt  +downstreamnt
atgtctataaatataagagaccctcttatagtaagcagagttgttggagacgttcttgat
ccgtttaatagatcaatcactctaaaggttacttatggccaaagagaggtgactaatggc
ttggatctaaggccttctcaggttcaaaacaagccaagagttgagattggtggagaagac
ctcaggaacttctatactttggttatggtggatccagatgttccaagtcctagcaaccct
cacctccgagaatatctccattggttggtgactgatatccctgctacaactggaacaacc
tttggcaatgagattgtgtgttacgaaaatccaagtcccactgcaggaattcatcgtgtc
gtgtttatattgtttcgacagcttggcaggcaaacagtgtatgcaccagggtggcgccag
aacttcaacactcgcgagtttgctgagatctacaatctcggccttcccgtggccgcagtt
ttctacaattgtcagagggagagtggctgcggaggaagaagactttag

KEGG   Arabidopsis thaliana (thale cress): AT4G20370
Entry
AT4G20370         CDS       T00041                                 

Symbol
TSF
Name
(RefSeq) PEBP (phosphatidylethanolamine-binding protein) family protein
  KO
K16223  protein FLOWERING LOCUS T
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    AT4G20370 (TSF)
SSDB
Motif
Pfam: PBP
Other DBs
NCBI-GeneID: 827785
NCBI-ProteinID: NP_193770
TAIR: AT4G20370
UniProt: Q9S7R5 Q587R2 A0A384LHR7
LinkDB
Position
4:complement(11000771..11003010)
AA seq 175 aa
MSLSRRDPLVVGSVVGDVLDPFTRLVSLKVTYGHREVTNGLDLRPSQVLNKPIVEIGGDD
FRNFYTLVMVDPDVPSPSNPHQREYLHWLVTDIPATTGNAFGNEVVCYESPRPPSGIHRI
VLVLFRQLGRQTVYAPGWRQQFNTREFAEIYNLGLPVAASYFNCQRENGCGGRRT
NT seq 528 nt   +upstreamnt  +downstreamnt
atgtctttaagtcgtagagatcctcttgtggtcggcagtgttgttggagatgttcttgat
cctttcacgaggttggtctctcttaaggtcacttatggccatagagaggttactaatggc
ttggatctaaggccttctcaagttctgaacaaaccaatagtggagattggaggagacgac
ttcagaaatttctacaccttggttatggtggatccagatgtgccgagtccaagcaaccct
caccaacgagaatatctccactggttggtgactgatatacctgccaccactggaaatgcc
tttggcaatgaggtggtgtgctacgagagtccacgtcccccctcgggaattcatcgtatt
gtgttggtattgttccggcaactcggaagacaaacggtttatgcaccggggtggcgccaa
cagttcaacactcgtgagtttgctgagatctacaatcttggtcttcctgtggctgcctct
tacttcaactgccagagggagaatggctgtgggggaagaagaacgtag

DBGET integrated database retrieval system