KEGG   Arabidopsis thaliana (thale cress): AT2G01490
Entry
AT2G01490         CDS       T00041                                 
Symbol
PAHX
Name
(RefSeq) phytanoyl-CoA dioxygenase (PhyH) family protein
  KO
K00477  phytanoyl-CoA hydroxylase [EC:1.14.11.18]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT2G01490 (PAHX)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.18  phytanoyl-CoA dioxygenase
     AT2G01490 (PAHX)
SSDB
Motif
Pfam: PhyH
Other DBs
NCBI-GeneID: 814677
NCBI-ProteinID: NP_001325094
TAIR: AT2G01490
UniProt: Q9ZVF6
LinkDB
Position
2:221013..223809
AA seq 283 aa
MGITGSLTPDQLDFFHSQGYLVIESFASEDEIRGLRKRMDELLNQFDCSVSSIFSTKNQK
HTTDNYFFESAEKISFFFEEKAFGDDGKLKQPKQLSINKVGHALHELDPLYKDFTYSSKF
SSLASSLGYRRPVVMQSMYIFKQPGIGGEVVPHQDNSFVYTDPQSCTGLWIALEDSTLVN
GCLWAIPGSHKNGLVRRFIRGDNGITFDQPSPSYEQKDFVSIEMKAGSLIAIHGDLIHQS
FENLSSKSRHAYSLHVVESDGCKWAKDNWIQRAKMPEPLYVLP
NT seq 852 nt   +upstreamnt  +downstreamnt
atgggaatcaccggaagtctaacgccagatcagctcgattttttccactctcaagggtat
ttggtaatcgaatcgttcgcgagtgaggatgagataagaggcttaaggaagaggatggat
gagttgcttaatcagtttgattgttccgtctcctctatcttctccaccaaaaatcagaag
cacaccacagataattacttctttgagagcgctgagaaaatctccttcttctttgaagaa
aaagcttttggtgatgatgggaaattgaagcaacccaaacaactctctataaacaaagtt
gggcatgcactgcatgagcttgacccattgtataaggatttcacatattcgtcaaagttt
tcaagtttggcatcatccttaggttacaggagaccagttgtcatgcagtctatgtatatt
ttcaagcaacctggaattggaggcgaagttgtgccgcaccaagataattcttttgtgtac
acggatccacagagttgtactggtctctggattgctcttgaagattctacattagttaat
ggttgtctttgggcaattcctggatctcataagaatggtttagttagaaggtttatccgt
ggtgacaacggtataacctttgatcagccatccccatcttacgagcagaaagattttgtg
tctattgaaatgaaagcaggctcattgattgccattcatggtgatctaatccatcaaagt
ttcgagaatctatcctcgaagtcaagacatgcctatagcttacatgtagtagaatctgat
ggatgtaaatgggcaaaagacaactggatacaaagagcaaaaatgccggagcctctctat
gttcttccttga

DBGET integrated database retrieval system