KEGG   Arabidopsis thaliana (thale cress): AT2G07640
Entry
AT2G07640         CDS       T00041                                 
Name
(RefSeq) NAD(P)-binding Rossmann-fold superfamily protein
  KO
K13237  2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], peroxisomal [EC:1.3.1.124]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT2G07640
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.124  2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]
     AT2G07640
SSDB
Motif
Pfam: adh_short_C2 adh_short
Other DBs
NCBI-GeneID: 815336
NCBI-ProteinID: NP_178765
TAIR: AT2G07640
UniProt: Q9XE46 A0A654ESD6
LinkDB
Position
2:3220739..3221422
AA seq 156 aa
MCHAALKYLKKVAPGRDSSSGGGSIINISATLHYTASRYQIHVSAAKVAVDATTRNLALE
WGTDYDIRVNGIATGPIGGTPGMSKLVPEEIENKTREYMPLYKLGEKWDIAMAALYLSCD
SGKYMSGLTMVVDGGLCLSKPRHLAKEWRRGLGPGE
NT seq 471 nt   +upstreamnt  +downstreamnt
atgtgtcacgcagctctcaagtatcttaagaaagtagcgcctggaagagactcatcaagc
ggtggcggttcgattattaacataagcgctactttgcactacacagcttctaggtatcaa
atacatgtatctgcagccaaggttgcagttgatgctaccacaagaaacttggcattggag
tggggaactgactatgatattagagtgaacggaattgctacaggtcctattggaggtaca
ccgggaatgagtaaacttgtacctgaggagattgaaaacaaaaccagagagtacatgcct
ctttataaacttggagagaagtgggatatcgcaatggctgcactctacttgagctgtgat
tctgggaaatatatgagtggactaacaatggtggtagatggaggactgtgtcttagcaaa
cctcgccatttggccaaagagtggagaagaggtctagggccaggcgaatga

KEGG   Arabidopsis thaliana (thale cress): AT3G12800
Entry
AT3G12800         CDS       T00041                                 
Symbol
SDRB
Name
(RefSeq) short-chain dehydrogenase-reductase B
  KO
K13237  2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], peroxisomal [EC:1.3.1.124]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT3G12800 (SDRB)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.124  2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]
     AT3G12800 (SDRB)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Polysacc_synt_2
Other DBs
NCBI-GeneID: 820462
NCBI-ProteinID: NP_187886
TAIR: AT3G12800
UniProt: Q9LTV6 A0A654F6I3 Q0WMN4
LinkDB
Position
3:complement(4063320..4064859)
AA seq 298 aa
MDSPFKPDVVRGQVALITGGGSGIGFEISSQFGKHGASIAIMGRRKQVLDDAVSALRSLG
IQAIGLEGDVRKQEDARRVVEATFQHFGKLDILVNAAAGNFLAAAEDLSPNGFRTVLDID
AVGTFNMCHAALKYLKKGAPGRDSSSGGGSIINISATLHYTASWYQIHVSAAKAAVDATT
RNLALEWGTDYDIRVNGIAPGPIGGTPGMSKLVPEEIENKTREYMPLYKVGEKWDIAMAA
LYLSCDSGKYVSGLTMVVDGGLWLSKPRHLPKEAVKQLSRAVEKRSRAKPVGLPTSKL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggactctccgttcaaacctgatgtcgtcagaggtcaagtggctctcatcaccggtggt
ggatccggtatcggttttgagatctcttctcagtttggcaaacatggagcttctatcgct
atcatgggacgacgaaaacaagtcctcgatgacgccgtctctgctcttcgatctcttgga
atccaggctattggattggaaggtgatgttcgtaagcaagaagatgcgagaagagttgtg
gaagcaacttttcagcattttggtaaacttgatattcttgttaacgccgctgctggcaat
tttctggctgctgctgaggatttgtctcctaatggcttcagaacagtcttagacattgat
gcggtaggaacattcaacatgtgtcacgcagctctcaagtatcttaagaaaggagcgcct
ggaagagactcatcaagcggtggaggttcgattattaacattagcgcgactttgcactac
acggcttcttggtaccaaatacatgtctctgcagccaaggctgcagttgatgctaccaca
agaaacttggcattggagtggggaactgactatgatattagagtgaacgggattgctcca
ggtcctattggaggtacacctggaatgagtaaacttgtacctgaggagattgaaaacaaa
accagagagtacatgcctctttataaagttggagagaagtgggatatcgctatggctgca
ctctacctcagctgtgattctgggaaatatgtgagcggactaacaatggtggtagatgga
ggactgtggcttagcaaacctcgccacttgcctaaagaagcggtgaagcaactctctcgt
gcggtggagaagaggtctagggccaagcctgttggtctcccaaccagcaagctgtag

DBGET integrated database retrieval system